Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | GL189_RS10670 | Genome accession | NZ_CP046360 |
| Coordinates | 2084685..2084810 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799694.1 | Uniprot ID | Q9WW44 |
| Organism | Streptococcus pneumoniae strain 574 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2079685..2089810
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL189_RS11245 | - | 2080023..2081626 (-) | 1604 | Protein_2076 | YhgE/Pip family protein | - |
| GL189_RS10645 (GL189_10825) | - | 2081805..2082347 (+) | 543 | WP_001158269.1 | TetR/AcrR family transcriptional regulator | - |
| GL189_RS10660 (GL189_10840) | comE | 2082590..2083342 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| GL189_RS10665 (GL189_10845) | comD/comD2 | 2083339..2084664 (-) | 1326 | WP_024477997.1 | competence system sensor histidine kinase ComD | Regulator |
| GL189_RS10670 (GL189_10850) | comC/comC2 | 2084685..2084810 (-) | 126 | WP_000799694.1 | competence-stimulating peptide ComC | Regulator |
| GL189_RS10680 (GL189_10860) | rlmH | 2085092..2085571 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| GL189_RS10685 (GL189_10865) | htrA | 2085754..2086935 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| GL189_RS10690 (GL189_10870) | spo0J | 2086993..2087751 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| GL189_RS10695 (GL189_10875) | dnaA | 2087964..2089325 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4892.93 Da Isoelectric Point: 10.9061
>NTDB_id=403456 GL189_RS10670 WP_000799694.1 2084685..2084810(-) (comC/comC2) [Streptococcus pneumoniae strain 574]
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=403456 GL189_RS10670 WP_000799694.1 2084685..2084810(-) (comC/comC2) [Streptococcus pneumoniae strain 574]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |