Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | GL186_RS00105 | Genome accession | NZ_CP046358 |
| Coordinates | 20141..20377 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939544.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 566 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 18705..38141 | 20141..20377 | within | 0 |
| IScluster/Tn | 18197..19824 | 20141..20377 | flank | 317 |
Gene organization within MGE regions
Location: 18197..38141
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL186_RS00095 (GL186_00095) | - | 18197..19043 (+) | 847 | Protein_13 | IS630 family transposase | - |
| GL186_RS00100 (GL186_00100) | - | 19078..19875 (-) | 798 | Protein_14 | transposase | - |
| GL186_RS00105 (GL186_00105) | comW | 20141..20377 (+) | 237 | WP_000939544.1 | sigma(X)-activator ComW | Regulator |
| GL186_RS00110 (GL186_00110) | - | 20608..21894 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| GL186_RS00115 (GL186_00115) | tadA | 22095..22562 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| GL186_RS10890 (GL186_00125) | - | 22771..23469 (-) | 699 | WP_001106362.1 | tyrosine-type recombinase/integrase | - |
| GL186_RS10895 (GL186_00130) | - | 23559..23906 (-) | 348 | WP_001839379.1 | hypothetical protein | - |
| GL186_RS00130 (GL186_00135) | - | 23967..25037 (-) | 1071 | WP_000401841.1 | type I restriction endonuclease | - |
| GL186_RS00135 (GL186_00140) | - | 25054..25434 (-) | 381 | WP_000170931.1 | ImmA/IrrE family metallo-endopeptidase | - |
| GL186_RS00140 (GL186_00145) | - | 25447..25710 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE family toxin | - |
| GL186_RS00145 (GL186_00150) | - | 25710..25943 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| GL186_RS00150 (GL186_00155) | - | 25943..26311 (-) | 369 | WP_000464160.1 | helix-turn-helix domain-containing protein | - |
| GL186_RS00155 (GL186_00160) | - | 26883..27074 (+) | 192 | WP_001112859.1 | DNA-binding protein | - |
| GL186_RS00160 (GL186_00165) | - | 27097..27300 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| GL186_RS00165 (GL186_00170) | - | 27455..27622 (-) | 168 | WP_000024181.1 | YjzC family protein | - |
| GL186_RS00170 (GL186_00175) | - | 27627..28007 (+) | 381 | Protein_28 | autolysin | - |
| GL186_RS00175 (GL186_00180) | - | 28227..28406 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| GL186_RS00180 | - | 28548..28697 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| GL186_RS00185 (GL186_00185) | - | 29002..29445 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| GL186_RS00190 (GL186_00190) | - | 29447..29962 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| GL186_RS00195 (GL186_00195) | radA | 29976..31337 (+) | 1362 | WP_075213698.1 | DNA repair protein RadA | Machinery gene |
| GL186_RS00200 (GL186_00200) | - | 31410..31907 (+) | 498 | WP_001809263.1 | beta-class carbonic anhydrase | - |
| GL186_RS00205 (GL186_00205) | - | 31932..32715 (+) | 784 | Protein_35 | PrsW family glutamic-type intramembrane protease | - |
| GL186_RS00210 (GL186_00210) | - | 32860..33828 (+) | 969 | WP_000010157.1 | ribose-phosphate diphosphokinase | - |
| GL186_RS00215 (GL186_00215) | - | 33962..34243 (-) | 282 | Protein_37 | transposase family protein | - |
| GL186_RS10875 | - | 34370..35252 (-) | 883 | Protein_38 | Rpn family recombination-promoting nuclease/putative transposase | - |
| GL186_RS00235 (GL186_00235) | polA | 35508..38141 (+) | 2634 | WP_024477951.1 | DNA polymerase I | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9667.10 Da Isoelectric Point: 6.4701
>NTDB_id=403227 GL186_RS00105 WP_000939544.1 20141..20377(+) (comW) [Streptococcus pneumoniae strain 566]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=403227 GL186_RS00105 WP_000939544.1 20141..20377(+) (comW) [Streptococcus pneumoniae strain 566]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae D39 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae R6 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae TIGR4 |
97.436 |
100 |
0.974 |
| comW | Streptococcus mitis SK321 |
78.205 |
100 |
0.782 |
| comW | Streptococcus mitis NCTC 12261 |
77.922 |
98.718 |
0.769 |