Detailed information
Overview
| Name | pilX | Type | Machinery gene |
| Locus tag | GJE04_RS02775 | Genome accession | NZ_CP045961 |
| Coordinates | 518088..518561 (+) | Length | 157 a.a. |
| NCBI ID | WP_195183013.1 | Uniprot ID | - |
| Organism | Neisseria meningitidis strain AUSMDU00010537 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 513483..558090 | 518088..518561 | within | 0 |
Gene organization within MGE regions
Location: 513483..558090
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GJE04_RS02750 (GJE04_02750) | dnaB | 513483..514889 (+) | 1407 | WP_002213843.1 | replicative DNA helicase | - |
| GJE04_RS02755 (GJE04_02755) | pilH | 515198..515866 (+) | 669 | WP_014575282.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| GJE04_RS02760 (GJE04_02760) | pilV | 515896..516516 (+) | 621 | WP_154074400.1 | type IV pilus modification protein PilV | Machinery gene |
| GJE04_RS02765 (GJE04_02765) | pilJ | 516513..517511 (+) | 999 | WP_154074381.1 | PilW family protein | Machinery gene |
| GJE04_RS02770 (GJE04_02770) | pilK | 517490..518083 (+) | 594 | WP_002255851.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| GJE04_RS02775 (GJE04_02775) | pilX | 518088..518561 (+) | 474 | WP_195183013.1 | PilX family type IV pilin | Machinery gene |
| GJE04_RS02780 (GJE04_02780) | - | 519441..519869 (-) | 429 | Protein_511 | AzlC family ABC transporter permease | - |
| GJE04_RS02785 (GJE04_02785) | dut | 520012..520464 (+) | 453 | WP_002250021.1 | dUTP diphosphatase | - |
| GJE04_RS02790 (GJE04_02790) | dapC | 520540..521727 (+) | 1188 | WP_061727608.1 | succinyldiaminopimelate transaminase | - |
| GJE04_RS12380 | - | 521815..521940 (+) | 126 | Protein_514 | IS5/IS1182 family transposase | - |
| GJE04_RS02795 (GJE04_02795) | yaaA | 521989..522768 (+) | 780 | WP_002235690.1 | peroxide stress protein YaaA | - |
| GJE04_RS02810 (GJE04_02810) | - | 523325..524521 (+) | 1197 | WP_002223440.1 | tyrosine-type recombinase/integrase | - |
| GJE04_RS02815 (GJE04_02815) | - | 524678..525059 (+) | 382 | Protein_517 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| GJE04_RS02820 (GJE04_02820) | - | 525495..525974 (+) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| GJE04_RS02825 (GJE04_02825) | - | 526842..527759 (+) | 918 | WP_002220686.1 | KilA-N domain-containing protein | - |
| GJE04_RS02830 (GJE04_02830) | - | 527817..528026 (-) | 210 | WP_002220687.1 | hypothetical protein | - |
| GJE04_RS02835 (GJE04_02835) | - | 528023..528163 (-) | 141 | WP_002220688.1 | hypothetical protein | - |
| GJE04_RS02840 (GJE04_02840) | - | 528163..528354 (-) | 192 | WP_002219435.1 | type ISP restriction/modification enzyme | - |
| GJE04_RS02845 (GJE04_02845) | - | 528357..528650 (-) | 294 | WP_002220689.1 | hypothetical protein | - |
| GJE04_RS02850 (GJE04_02850) | - | 528647..528907 (-) | 261 | WP_002220690.1 | NGO1622 family putative holin | - |
| GJE04_RS02855 (GJE04_02855) | - | 528943..529158 (-) | 216 | WP_002220692.1 | hypothetical protein | - |
| GJE04_RS02860 (GJE04_02860) | - | 529230..530084 (-) | 855 | WP_002220693.1 | YfdQ family protein | - |
| GJE04_RS02865 (GJE04_02865) | - | 530109..530468 (-) | 360 | WP_002220694.1 | hypothetical protein | - |
| GJE04_RS02870 (GJE04_02870) | - | 530536..530736 (-) | 201 | WP_002219431.1 | hypothetical protein | - |
| GJE04_RS02875 (GJE04_02875) | - | 530967..531392 (-) | 426 | WP_002220695.1 | hypothetical protein | - |
| GJE04_RS02880 (GJE04_02880) | - | 531495..532211 (-) | 717 | WP_002220696.1 | S24 family peptidase | - |
| GJE04_RS02885 (GJE04_02885) | - | 532611..532958 (+) | 348 | WP_002220698.1 | hypothetical protein | - |
| GJE04_RS02890 (GJE04_02890) | - | 533073..535919 (+) | 2847 | WP_002220699.1 | primase-helicase family protein | - |
| GJE04_RS02895 (GJE04_02895) | - | 535936..536145 (+) | 210 | WP_002220700.1 | hypothetical protein | - |
| GJE04_RS02900 (GJE04_02900) | - | 536148..536534 (+) | 387 | WP_002220701.1 | DUF3310 domain-containing protein | - |
| GJE04_RS02905 (GJE04_02905) | - | 536521..536775 (+) | 255 | WP_002220702.1 | hypothetical protein | - |
| GJE04_RS02910 (GJE04_02910) | - | 536784..538346 (+) | 1563 | WP_002220703.1 | phage portal protein | - |
| GJE04_RS02915 (GJE04_02915) | - | 538327..540219 (+) | 1893 | WP_002220704.1 | phage major capsid protein | - |
| GJE04_RS02920 (GJE04_02920) | - | 540277..540504 (+) | 228 | WP_002220705.1 | hypothetical protein | - |
| GJE04_RS02925 (GJE04_02925) | - | 540497..540799 (+) | 303 | WP_002244523.1 | hypothetical protein | - |
| GJE04_RS02930 (GJE04_02930) | - | 540780..541199 (+) | 420 | WP_002244524.1 | hypothetical protein | - |
| GJE04_RS02935 (GJE04_02935) | - | 541231..541872 (+) | 642 | WP_002220708.1 | phage tail protein | - |
| GJE04_RS02940 (GJE04_02940) | - | 541936..542247 (+) | 312 | WP_002220709.1 | phage tail assembly chaperone | - |
| GJE04_RS02945 (GJE04_02945) | - | 542295..542567 (+) | 273 | WP_002220710.1 | DUF1799 domain-containing protein | - |
| GJE04_RS02950 (GJE04_02950) | - | 542560..545778 (+) | 3219 | WP_002224445.1 | phage tail length tape measure family protein | - |
| GJE04_RS02955 (GJE04_02955) | - | 545800..546069 (+) | 270 | WP_002217457.1 | phage tail protein | - |
| GJE04_RS02960 (GJE04_02960) | - | 546129..546851 (+) | 723 | WP_002217456.1 | phage minor tail protein L | - |
| GJE04_RS02965 (GJE04_02965) | - | 546848..547603 (+) | 756 | WP_002244525.1 | C40 family peptidase | - |
| GJE04_RS02970 (GJE04_02970) | - | 547600..548322 (+) | 723 | WP_002220716.1 | tail assembly protein | - |
| GJE04_RS02975 (GJE04_02975) | - | 548458..552723 (+) | 4266 | WP_002220717.1 | phage tail protein | - |
| GJE04_RS02980 (GJE04_02980) | - | 552794..553240 (+) | 447 | WP_002220718.1 | hypothetical protein | - |
| GJE04_RS12290 | - | 553257..553463 (+) | 207 | WP_002217448.1 | hypothetical protein | - |
| GJE04_RS02985 (GJE04_02985) | - | 553531..553902 (+) | 372 | WP_002220720.1 | hypothetical protein | - |
| GJE04_RS02990 (GJE04_02990) | - | 553966..554391 (+) | 426 | WP_002220721.1 | hypothetical protein | - |
| GJE04_RS02995 (GJE04_02995) | - | 554388..554663 (+) | 276 | WP_002217443.1 | hypothetical protein | - |
| GJE04_RS03000 (GJE04_03000) | - | 554802..555275 (+) | 474 | WP_002220733.1 | D-Ala-D-Ala carboxypeptidase family metallohydrolase | - |
| GJE04_RS03005 (GJE04_03005) | - | 555287..555796 (+) | 510 | WP_002220734.1 | hypothetical protein | - |
| GJE04_RS03010 (GJE04_03010) | - | 555849..556196 (-) | 348 | WP_002217440.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| GJE04_RS03015 (GJE04_03015) | - | 556198..556434 (-) | 237 | WP_002217439.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| GJE04_RS03020 (GJE04_03020) | - | 556793..557389 (-) | 597 | WP_229016375.1 | DUF4760 domain-containing protein | - |
| GJE04_RS03025 (GJE04_03025) | - | 557722..558090 (-) | 369 | WP_002220735.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17595.43 Da Isoelectric Point: 9.7023
>NTDB_id=399745 GJE04_RS02775 WP_195183013.1 518088..518561(+) (pilX) [Neisseria meningitidis strain AUSMDU00010537]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNISKQFILKNPLDDNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVRFVDKEKSRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDKASAEAYSETLFADAGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNISKQFILKNPLDDNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVRFVDKEKSRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDKASAEAYSETLFADAGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=399745 GJE04_RS02775 WP_195183013.1 518088..518561(+) (pilX) [Neisseria meningitidis strain AUSMDU00010537]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTCGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATATTTCCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAGGTTTGTCGATAAGGAAAAATCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCGGGGACGGGTTATACTCTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATAAGG
CTTCTGCCGAAGCCTATTCGGAGACCTTGTTCGCAGATGCCGGCTGTGAAGCCTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTCGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATATTTCCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAGGTTTGTCGATAAGGAAAAATCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCGGGGACGGGTTATACTCTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATAAGG
CTTCTGCCGAAGCCTATTCGGAGACCTTGTTCGCAGATGCCGGCTGTGAAGCCTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilX | Neisseria meningitidis 8013 |
90.446 |
100 |
0.904 |
| pilL | Neisseria gonorrhoeae MS11 |
89.172 |
100 |
0.892 |