Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GII82_RS12380 Genome accession   NZ_CP045819
Coordinates   2426999..2427382 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain MB9_B4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2421999..2432382
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII82_RS12340 (GII82_12340) sinI 2422932..2423105 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII82_RS12345 (GII82_12345) sinR 2423139..2423474 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII82_RS12350 (GII82_12350) tasA 2423567..2424352 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII82_RS12355 (GII82_12355) sipW 2424416..2424988 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII82_RS12360 (GII82_12360) tapA 2424972..2425733 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII82_RS12365 (GII82_12365) yqzG 2426005..2426331 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII82_RS12370 (GII82_12370) spoIITA 2426373..2426552 (-) 180 WP_029726723.1 YqzE family protein -
  GII82_RS12375 (GII82_12375) comGG 2426624..2426998 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII82_RS12380 (GII82_12380) comGF 2426999..2427382 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII82_RS12385 (GII82_12385) comGE 2427408..2427755 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  GII82_RS12390 (GII82_12390) comGD 2427739..2428170 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  GII82_RS12395 (GII82_12395) comGC 2428160..2428456 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  GII82_RS12400 (GII82_12400) comGB 2428470..2429507 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  GII82_RS12405 (GII82_12405) comGA 2429494..2430564 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII82_RS12410 (GII82_12410) - 2430777..2430974 (-) 198 WP_029726717.1 hypothetical protein -
  GII82_RS12415 (GII82_12415) corA 2430976..2431929 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=397902 GII82_RS12380 WP_029726721.1 2426999..2427382(-) (comGF) [Bacillus subtilis strain MB9_B4]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=397902 GII82_RS12380 WP_029726721.1 2426999..2427382(-) (comGF) [Bacillus subtilis strain MB9_B4]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment