Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII82_RS12340 Genome accession   NZ_CP045819
Coordinates   2422932..2423105 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain MB9_B4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2417932..2428105
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII82_RS12325 (GII82_12325) gcvT 2418732..2419820 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  GII82_RS12330 (GII82_12330) hepAA 2420261..2421934 (+) 1674 WP_029726726.1 SNF2-related protein -
  GII82_RS12335 (GII82_12335) yqhG 2421955..2422749 (+) 795 WP_015714249.1 YqhG family protein -
  GII82_RS12340 (GII82_12340) sinI 2422932..2423105 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII82_RS12345 (GII82_12345) sinR 2423139..2423474 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII82_RS12350 (GII82_12350) tasA 2423567..2424352 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII82_RS12355 (GII82_12355) sipW 2424416..2424988 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII82_RS12360 (GII82_12360) tapA 2424972..2425733 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII82_RS12365 (GII82_12365) yqzG 2426005..2426331 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII82_RS12370 (GII82_12370) spoIITA 2426373..2426552 (-) 180 WP_029726723.1 YqzE family protein -
  GII82_RS12375 (GII82_12375) comGG 2426624..2426998 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII82_RS12380 (GII82_12380) comGF 2426999..2427382 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII82_RS12385 (GII82_12385) comGE 2427408..2427755 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=397899 GII82_RS12340 WP_003230187.1 2422932..2423105(+) (sinI) [Bacillus subtilis strain MB9_B4]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=397899 GII82_RS12340 WP_003230187.1 2422932..2423105(+) (sinI) [Bacillus subtilis strain MB9_B4]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment