Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GII89_RS17150 Genome accession   NZ_CP045812
Coordinates   3256679..3256819 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain P8_B3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3251679..3261819
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII89_RS17125 (GII89_17125) yuxO 3251992..3252372 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  GII89_RS17130 (GII89_17130) comA 3252391..3253035 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII89_RS17135 (GII89_17135) comP 3253116..3255425 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  GII89_RS17140 (GII89_17140) comX 3255440..3255607 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII89_RS17145 (GII89_17145) comQ 3255595..3256494 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII89_RS17150 (GII89_17150) degQ 3256679..3256819 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII89_RS17155 (GII89_17155) - 3257041..3257166 (+) 126 WP_003228793.1 hypothetical protein -
  GII89_RS17160 (GII89_17160) - 3257280..3257648 (+) 369 WP_003243784.1 hypothetical protein -
  GII89_RS17165 (GII89_17165) pdeH 3257624..3258853 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII89_RS17170 (GII89_17170) pncB 3258990..3260462 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GII89_RS17175 (GII89_17175) pncA 3260478..3261029 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  GII89_RS17180 (GII89_17180) yueI 3261126..3261524 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=397534 GII89_RS17150 WP_003220708.1 3256679..3256819(-) (degQ) [Bacillus subtilis strain P8_B3]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=397534 GII89_RS17150 WP_003220708.1 3256679..3256819(-) (degQ) [Bacillus subtilis strain P8_B3]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment