Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   GII89_RS17140 Genome accession   NZ_CP045812
Coordinates   3255440..3255607 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain P8_B3     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250440..3260607
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII89_RS17110 (GII89_17110) mrpE 3250835..3251311 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  GII89_RS17115 (GII89_17115) mrpF 3251311..3251595 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  GII89_RS17120 (GII89_17120) mnhG 3251579..3251953 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  GII89_RS17125 (GII89_17125) yuxO 3251992..3252372 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  GII89_RS17130 (GII89_17130) comA 3252391..3253035 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII89_RS17135 (GII89_17135) comP 3253116..3255425 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  GII89_RS17140 (GII89_17140) comX 3255440..3255607 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII89_RS17145 (GII89_17145) comQ 3255595..3256494 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII89_RS17150 (GII89_17150) degQ 3256679..3256819 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII89_RS17155 (GII89_17155) - 3257041..3257166 (+) 126 WP_003228793.1 hypothetical protein -
  GII89_RS17160 (GII89_17160) - 3257280..3257648 (+) 369 WP_003243784.1 hypothetical protein -
  GII89_RS17165 (GII89_17165) pdeH 3257624..3258853 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII89_RS17170 (GII89_17170) pncB 3258990..3260462 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=397532 GII89_RS17140 WP_003242801.1 3255440..3255607(-) (comX) [Bacillus subtilis strain P8_B3]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=397532 GII89_RS17140 WP_003242801.1 3255440..3255607(-) (comX) [Bacillus subtilis strain P8_B3]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment