Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BSN5_RS02860 Genome accession   NC_014976
Coordinates   535651..536034 (-) Length   127 a.a.
NCBI ID   WP_038429292.1    Uniprot ID   -
Organism   Bacillus subtilis BSn5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 530651..541034
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSN5_RS02820 (BSn5_02850) sinI 531585..531758 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSN5_RS02825 (BSn5_02855) sinR 531792..532127 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSN5_RS02830 (BSn5_02860) tasA 532220..533005 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  BSN5_RS02835 (BSn5_02865) sipW 533069..533641 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BSN5_RS02840 (BSn5_02870) tapA 533625..534386 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  BSN5_RS02845 (BSn5_02875) yqzG 534658..534984 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSN5_RS02850 (BSn5_02880) spoIITA 535026..535205 (-) 180 WP_014480252.1 YqzE family protein -
  BSN5_RS02855 (BSn5_02885) comGG 535276..535650 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  BSN5_RS02860 (BSn5_02890) comGF 535651..536034 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  BSN5_RS02865 (BSn5_02895) comGE 536060..536407 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  BSN5_RS02870 (BSn5_02900) comGD 536391..536822 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  BSN5_RS02875 (BSn5_02905) comGC 536812..537108 (-) 297 WP_015714256.1 comG operon protein ComGC Machinery gene
  BSN5_RS02880 (BSn5_02910) comGB 537122..538159 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  BSN5_RS02885 (BSn5_02915) comGA 538146..539216 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  BSN5_RS02895 (BSn5_02920) - 539428..539625 (-) 198 WP_014480259.1 CBS domain-containing protein -
  BSN5_RS02900 (BSn5_02925) corA 539627..540580 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14547.68 Da        Isoelectric Point: 6.4849

>NTDB_id=39740 BSN5_RS02860 WP_038429292.1 535651..536034(-) (comGF) [Bacillus subtilis BSn5]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSRQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=39740 BSN5_RS02860 WP_038429292.1 535651..536034(-) (comGF) [Bacillus subtilis BSn5]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATTTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCAGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.619

99.213

0.969


Multiple sequence alignment