Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BSN5_RS02820 Genome accession   NC_014976
Coordinates   531585..531758 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis BSn5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 526585..536758
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSN5_RS02805 (BSn5_02835) gcvT 527384..528472 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  BSN5_RS02810 (BSn5_02840) hepAA 528914..530587 (+) 1674 WP_003230203.1 SNF2-related protein -
  BSN5_RS02815 (BSn5_02845) yqhG 530608..531402 (+) 795 WP_015714249.1 YqhG family protein -
  BSN5_RS02820 (BSn5_02850) sinI 531585..531758 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSN5_RS02825 (BSn5_02855) sinR 531792..532127 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSN5_RS02830 (BSn5_02860) tasA 532220..533005 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  BSN5_RS02835 (BSn5_02865) sipW 533069..533641 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BSN5_RS02840 (BSn5_02870) tapA 533625..534386 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  BSN5_RS02845 (BSn5_02875) yqzG 534658..534984 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSN5_RS02850 (BSn5_02880) spoIITA 535026..535205 (-) 180 WP_014480252.1 YqzE family protein -
  BSN5_RS02855 (BSn5_02885) comGG 535276..535650 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  BSN5_RS02860 (BSn5_02890) comGF 535651..536034 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  BSN5_RS02865 (BSn5_02895) comGE 536060..536407 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=39737 BSN5_RS02820 WP_003230187.1 531585..531758(+) (sinI) [Bacillus subtilis BSn5]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=39737 BSN5_RS02820 WP_003230187.1 531585..531758(+) (sinI) [Bacillus subtilis BSn5]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment