Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   GA660_RS01120 Genome accession   NZ_CP045129
Coordinates   243777..244343 (+) Length   188 a.a.
NCBI ID   WP_005180729.1    Uniprot ID   -
Organism   Acinetobacter indicus strain TQ04     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 244500..294343 243777..244343 flank 157


Gene organization within MGE regions


Location: 243777..294343
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GA660_RS01120 ssb 243777..244343 (+) 567 WP_005180729.1 single-stranded DNA-binding protein Machinery gene
  GA660_RS01125 - 244500..245723 (+) 1224 WP_104988036.1 site-specific integrase -
  GA660_RS01130 - 245720..246205 (+) 486 Protein_219 site-specific integrase -
  GA660_RS01140 - 247477..248562 (+) 1086 Protein_221 site-specific integrase -
  GA660_RS01145 - 248555..250678 (+) 2124 WP_104988038.1 integrase -
  GA660_RS01150 - 250680..251099 (+) 420 WP_104988039.1 hypothetical protein -
  GA660_RS01155 - 251176..251664 (-) 489 WP_168382385.1 hypothetical protein -
  GA660_RS01160 - 251761..251976 (+) 216 WP_019385588.1 helix-turn-helix domain-containing protein -
  GA660_RS01165 - 252094..253184 (+) 1091 Protein_226 IS3 family transposase -
  GA660_RS01170 - 253219..253440 (-) 222 WP_005180724.1 hypothetical protein -
  GA660_RS01175 - 253464..254384 (-) 921 WP_104988042.1 copper resistance protein B -
  GA660_RS01180 - 254371..256227 (-) 1857 WP_160240875.1 copper resistance system multicopper oxidase -
  GA660_RS01185 - 256317..256613 (-) 297 WP_045796009.1 hypothetical protein -
  GA660_RS01190 - 256762..257442 (+) 681 WP_004679347.1 heavy metal response regulator transcription factor -
  GA660_RS01195 - 257435..258835 (+) 1401 WP_045796008.1 heavy metal sensor histidine kinase -
  GA660_RS01200 - 258874..260157 (-) 1284 WP_045796007.1 MgtC/SapB family protein -
  GA660_RS01205 - 260154..262529 (-) 2376 WP_138001011.1 heavy metal translocating P-type ATPase -
  GA660_RS01210 - 262541..263191 (-) 651 WP_004663997.1 methyltransferase family protein -
  GA660_RS01215 - 263188..263460 (-) 273 WP_045796005.1 DUF2933 domain-containing protein -
  GA660_RS01220 - 263489..263920 (-) 432 WP_045796004.1 hypothetical protein -
  GA660_RS01225 - 264646..264888 (-) 243 WP_004281876.1 DUF2789 family protein -
  GA660_RS01230 - 265240..265620 (+) 381 WP_004681441.1 copper resistance protein CopC -
  GA660_RS01235 - 265685..266566 (+) 882 WP_045796003.1 CopD family protein -
  GA660_RS01240 - 267036..267230 (+) 195 WP_004733233.1 heavy-metal-associated domain-containing protein -
  GA660_RS01245 - 267296..267502 (-) 207 Protein_242 IS1 family transposase -
  GA660_RS01250 - 267922..268536 (-) 615 WP_045796002.1 thiol:disulfide interchange protein DsbA/DsbL -
  GA660_RS01255 - 269147..269845 (-) 699 Protein_244 IS6 family transposase -
  GA660_RS01260 - 269909..270496 (-) 588 Protein_245 cation transporter -
  GA660_RS01265 - 270575..271709 (+) 1135 Protein_246 IS3 family transposase -
  GA660_RS01270 - 271760..272464 (-) 705 Protein_247 cation transporter -
  GA660_RS01275 cadR 272554..272946 (+) 393 WP_000550240.1 Cd(II)/Pb(II)-responsive transcriptional regulator -
  GA660_RS01280 - 273040..273201 (+) 162 Protein_249 IS6 family transposase -
  GA660_RS01285 - 273243..273545 (-) 303 WP_001140620.1 helix-turn-helix domain-containing protein -
  GA660_RS01290 - 273538..273735 (-) 198 Protein_251 type II toxin-antitoxin system RelE/ParE family toxin -
  GA660_RS01295 - 273774..274852 (-) 1079 Protein_252 IS3 family transposase -
  GA660_RS01300 - 275185..275553 (+) 369 WP_005096107.1 cation efflux protein, CzcI-like -
  GA660_RS01305 - 275602..276927 (+) 1326 WP_160240877.1 TolC family protein -
  GA660_RS01310 - 276929..278158 (+) 1230 WP_016658777.1 efflux RND transporter periplasmic adaptor subunit -
  GA660_RS01315 - 278148..281288 (+) 3141 WP_160240879.1 efflux RND transporter permease subunit -
  GA660_RS01320 - 281375..281893 (+) 519 Protein_257 cation diffusion facilitator family transporter -
  GA660_RS01330 - 283176..283559 (+) 384 Protein_259 cation diffusion facilitator family transporter -
  GA660_RS01335 - 283743..284336 (+) 594 WP_104988051.1 recombinase family protein -
  GA660_RS01340 - 284399..285505 (-) 1107 WP_104988052.1 ImmA/IrrE family metallo-endopeptidase -
  GA660_RS01345 - 285518..286228 (-) 711 WP_104988053.1 hypothetical protein -
  GA660_RS01350 - 286762..287295 (+) 534 WP_160240881.1 hypothetical protein -
  GA660_RS01355 - 287342..288220 (+) 879 WP_160240882.1 hypothetical protein -
  GA660_RS01360 - 288316..289188 (+) 873 WP_104988056.1 restriction endonuclease -
  GA660_RS01365 - 289378..289629 (+) 252 WP_104988057.1 DUF4041 domain-containing protein -
  GA660_RS01370 - 290514..292379 (+) 1866 WP_104988058.1 copper resistance system multicopper oxidase -
  GA660_RS01375 - 292366..292704 (+) 339 WP_104988059.1 hypothetical protein -
  GA660_RS01380 - 292691..293635 (+) 945 WP_004668309.1 copper resistance protein B -
  GA660_RS01385 - 293815..294060 (+) 246 WP_104988060.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
  GA660_RS01390 - 294050..294343 (+) 294 WP_000221358.1 type II toxin-antitoxin system RelE family toxin -

Sequence


Protein


Download         Length: 188 a.a.        Molecular weight: 20640.39 Da        Isoelectric Point: 6.4819

>NTDB_id=392114 GA660_RS01120 WP_005180729.1 243777..244343(+) (ssb) [Acinetobacter indicus strain TQ04]
MRGVNKVILVGTLGRDPETKTFPNGGSLTQFSIATSDAWTDKTTGERKEQTEWHRIVLHNRLGEIAQQYLRKGSKVYIEG
SLRTRQWTDQNGQERYTTEIRGEQMQMLDSGRQQGEQGDNGFSQPRFNNNQGGGYSNNNQGGYAPQAQGGFNNNNAGGGY
GNQGGYQQPKPAPAATPAPADLDDDLPF

Nucleotide


Download         Length: 567 bp        

>NTDB_id=392114 GA660_RS01120 WP_005180729.1 243777..244343(+) (ssb) [Acinetobacter indicus strain TQ04]
ATGCGTGGTGTAAATAAGGTCATTTTAGTTGGTACTTTAGGTCGAGATCCAGAAACAAAAACTTTCCCGAATGGTGGCTC
GCTTACTCAATTTTCCATTGCCACCAGTGATGCGTGGACCGATAAAACCACCGGTGAGCGTAAAGAGCAAACCGAATGGC
ACCGTATTGTGCTGCATAACCGTTTAGGTGAAATCGCGCAGCAATACTTACGCAAAGGTTCAAAAGTCTATATTGAAGGT
TCGCTGCGTACCCGTCAGTGGACCGATCAGAATGGTCAGGAACGCTACACCACAGAAATTCGTGGCGAGCAAATGCAGAT
GCTGGACTCTGGTCGTCAGCAAGGTGAGCAGGGCGATAATGGTTTTAGCCAGCCACGTTTTAACAATAACCAGGGCGGTG
GTTATAGCAATAACAACCAGGGTGGCTATGCGCCGCAAGCTCAAGGCGGTTTTAACAACAATAATGCTGGTGGTGGCTAT
GGCAACCAGGGCGGTTATCAGCAACCGAAACCAGCTCCTGCTGCAACGCCTGCACCGGCAGATTTGGATGATGACTTACC
GTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

51.546

100

0.532

  ssb Vibrio cholerae strain A1552

43.939

100

0.463

  ssb Neisseria meningitidis MC58

38.421

100

0.388

  ssb Neisseria gonorrhoeae MS11

38.421

100

0.388


Multiple sequence alignment