Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | GA660_RS01120 | Genome accession | NZ_CP045129 |
| Coordinates | 243777..244343 (+) | Length | 188 a.a. |
| NCBI ID | WP_005180729.1 | Uniprot ID | - |
| Organism | Acinetobacter indicus strain TQ04 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 244500..294343 | 243777..244343 | flank | 157 |
Gene organization within MGE regions
Location: 243777..294343
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GA660_RS01120 | ssb | 243777..244343 (+) | 567 | WP_005180729.1 | single-stranded DNA-binding protein | Machinery gene |
| GA660_RS01125 | - | 244500..245723 (+) | 1224 | WP_104988036.1 | site-specific integrase | - |
| GA660_RS01130 | - | 245720..246205 (+) | 486 | Protein_219 | site-specific integrase | - |
| GA660_RS01140 | - | 247477..248562 (+) | 1086 | Protein_221 | site-specific integrase | - |
| GA660_RS01145 | - | 248555..250678 (+) | 2124 | WP_104988038.1 | integrase | - |
| GA660_RS01150 | - | 250680..251099 (+) | 420 | WP_104988039.1 | hypothetical protein | - |
| GA660_RS01155 | - | 251176..251664 (-) | 489 | WP_168382385.1 | hypothetical protein | - |
| GA660_RS01160 | - | 251761..251976 (+) | 216 | WP_019385588.1 | helix-turn-helix domain-containing protein | - |
| GA660_RS01165 | - | 252094..253184 (+) | 1091 | Protein_226 | IS3 family transposase | - |
| GA660_RS01170 | - | 253219..253440 (-) | 222 | WP_005180724.1 | hypothetical protein | - |
| GA660_RS01175 | - | 253464..254384 (-) | 921 | WP_104988042.1 | copper resistance protein B | - |
| GA660_RS01180 | - | 254371..256227 (-) | 1857 | WP_160240875.1 | copper resistance system multicopper oxidase | - |
| GA660_RS01185 | - | 256317..256613 (-) | 297 | WP_045796009.1 | hypothetical protein | - |
| GA660_RS01190 | - | 256762..257442 (+) | 681 | WP_004679347.1 | heavy metal response regulator transcription factor | - |
| GA660_RS01195 | - | 257435..258835 (+) | 1401 | WP_045796008.1 | heavy metal sensor histidine kinase | - |
| GA660_RS01200 | - | 258874..260157 (-) | 1284 | WP_045796007.1 | MgtC/SapB family protein | - |
| GA660_RS01205 | - | 260154..262529 (-) | 2376 | WP_138001011.1 | heavy metal translocating P-type ATPase | - |
| GA660_RS01210 | - | 262541..263191 (-) | 651 | WP_004663997.1 | methyltransferase family protein | - |
| GA660_RS01215 | - | 263188..263460 (-) | 273 | WP_045796005.1 | DUF2933 domain-containing protein | - |
| GA660_RS01220 | - | 263489..263920 (-) | 432 | WP_045796004.1 | hypothetical protein | - |
| GA660_RS01225 | - | 264646..264888 (-) | 243 | WP_004281876.1 | DUF2789 family protein | - |
| GA660_RS01230 | - | 265240..265620 (+) | 381 | WP_004681441.1 | copper resistance protein CopC | - |
| GA660_RS01235 | - | 265685..266566 (+) | 882 | WP_045796003.1 | CopD family protein | - |
| GA660_RS01240 | - | 267036..267230 (+) | 195 | WP_004733233.1 | heavy-metal-associated domain-containing protein | - |
| GA660_RS01245 | - | 267296..267502 (-) | 207 | Protein_242 | IS1 family transposase | - |
| GA660_RS01250 | - | 267922..268536 (-) | 615 | WP_045796002.1 | thiol:disulfide interchange protein DsbA/DsbL | - |
| GA660_RS01255 | - | 269147..269845 (-) | 699 | Protein_244 | IS6 family transposase | - |
| GA660_RS01260 | - | 269909..270496 (-) | 588 | Protein_245 | cation transporter | - |
| GA660_RS01265 | - | 270575..271709 (+) | 1135 | Protein_246 | IS3 family transposase | - |
| GA660_RS01270 | - | 271760..272464 (-) | 705 | Protein_247 | cation transporter | - |
| GA660_RS01275 | cadR | 272554..272946 (+) | 393 | WP_000550240.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
| GA660_RS01280 | - | 273040..273201 (+) | 162 | Protein_249 | IS6 family transposase | - |
| GA660_RS01285 | - | 273243..273545 (-) | 303 | WP_001140620.1 | helix-turn-helix domain-containing protein | - |
| GA660_RS01290 | - | 273538..273735 (-) | 198 | Protein_251 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| GA660_RS01295 | - | 273774..274852 (-) | 1079 | Protein_252 | IS3 family transposase | - |
| GA660_RS01300 | - | 275185..275553 (+) | 369 | WP_005096107.1 | cation efflux protein, CzcI-like | - |
| GA660_RS01305 | - | 275602..276927 (+) | 1326 | WP_160240877.1 | TolC family protein | - |
| GA660_RS01310 | - | 276929..278158 (+) | 1230 | WP_016658777.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GA660_RS01315 | - | 278148..281288 (+) | 3141 | WP_160240879.1 | efflux RND transporter permease subunit | - |
| GA660_RS01320 | - | 281375..281893 (+) | 519 | Protein_257 | cation diffusion facilitator family transporter | - |
| GA660_RS01330 | - | 283176..283559 (+) | 384 | Protein_259 | cation diffusion facilitator family transporter | - |
| GA660_RS01335 | - | 283743..284336 (+) | 594 | WP_104988051.1 | recombinase family protein | - |
| GA660_RS01340 | - | 284399..285505 (-) | 1107 | WP_104988052.1 | ImmA/IrrE family metallo-endopeptidase | - |
| GA660_RS01345 | - | 285518..286228 (-) | 711 | WP_104988053.1 | hypothetical protein | - |
| GA660_RS01350 | - | 286762..287295 (+) | 534 | WP_160240881.1 | hypothetical protein | - |
| GA660_RS01355 | - | 287342..288220 (+) | 879 | WP_160240882.1 | hypothetical protein | - |
| GA660_RS01360 | - | 288316..289188 (+) | 873 | WP_104988056.1 | restriction endonuclease | - |
| GA660_RS01365 | - | 289378..289629 (+) | 252 | WP_104988057.1 | DUF4041 domain-containing protein | - |
| GA660_RS01370 | - | 290514..292379 (+) | 1866 | WP_104988058.1 | copper resistance system multicopper oxidase | - |
| GA660_RS01375 | - | 292366..292704 (+) | 339 | WP_104988059.1 | hypothetical protein | - |
| GA660_RS01380 | - | 292691..293635 (+) | 945 | WP_004668309.1 | copper resistance protein B | - |
| GA660_RS01385 | - | 293815..294060 (+) | 246 | WP_104988060.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| GA660_RS01390 | - | 294050..294343 (+) | 294 | WP_000221358.1 | type II toxin-antitoxin system RelE family toxin | - |
Sequence
Protein
Download Length: 188 a.a. Molecular weight: 20640.39 Da Isoelectric Point: 6.4819
>NTDB_id=392114 GA660_RS01120 WP_005180729.1 243777..244343(+) (ssb) [Acinetobacter indicus strain TQ04]
MRGVNKVILVGTLGRDPETKTFPNGGSLTQFSIATSDAWTDKTTGERKEQTEWHRIVLHNRLGEIAQQYLRKGSKVYIEG
SLRTRQWTDQNGQERYTTEIRGEQMQMLDSGRQQGEQGDNGFSQPRFNNNQGGGYSNNNQGGYAPQAQGGFNNNNAGGGY
GNQGGYQQPKPAPAATPAPADLDDDLPF
MRGVNKVILVGTLGRDPETKTFPNGGSLTQFSIATSDAWTDKTTGERKEQTEWHRIVLHNRLGEIAQQYLRKGSKVYIEG
SLRTRQWTDQNGQERYTTEIRGEQMQMLDSGRQQGEQGDNGFSQPRFNNNQGGGYSNNNQGGYAPQAQGGFNNNNAGGGY
GNQGGYQQPKPAPAATPAPADLDDDLPF
Nucleotide
Download Length: 567 bp
>NTDB_id=392114 GA660_RS01120 WP_005180729.1 243777..244343(+) (ssb) [Acinetobacter indicus strain TQ04]
ATGCGTGGTGTAAATAAGGTCATTTTAGTTGGTACTTTAGGTCGAGATCCAGAAACAAAAACTTTCCCGAATGGTGGCTC
GCTTACTCAATTTTCCATTGCCACCAGTGATGCGTGGACCGATAAAACCACCGGTGAGCGTAAAGAGCAAACCGAATGGC
ACCGTATTGTGCTGCATAACCGTTTAGGTGAAATCGCGCAGCAATACTTACGCAAAGGTTCAAAAGTCTATATTGAAGGT
TCGCTGCGTACCCGTCAGTGGACCGATCAGAATGGTCAGGAACGCTACACCACAGAAATTCGTGGCGAGCAAATGCAGAT
GCTGGACTCTGGTCGTCAGCAAGGTGAGCAGGGCGATAATGGTTTTAGCCAGCCACGTTTTAACAATAACCAGGGCGGTG
GTTATAGCAATAACAACCAGGGTGGCTATGCGCCGCAAGCTCAAGGCGGTTTTAACAACAATAATGCTGGTGGTGGCTAT
GGCAACCAGGGCGGTTATCAGCAACCGAAACCAGCTCCTGCTGCAACGCCTGCACCGGCAGATTTGGATGATGACTTACC
GTTCTAG
ATGCGTGGTGTAAATAAGGTCATTTTAGTTGGTACTTTAGGTCGAGATCCAGAAACAAAAACTTTCCCGAATGGTGGCTC
GCTTACTCAATTTTCCATTGCCACCAGTGATGCGTGGACCGATAAAACCACCGGTGAGCGTAAAGAGCAAACCGAATGGC
ACCGTATTGTGCTGCATAACCGTTTAGGTGAAATCGCGCAGCAATACTTACGCAAAGGTTCAAAAGTCTATATTGAAGGT
TCGCTGCGTACCCGTCAGTGGACCGATCAGAATGGTCAGGAACGCTACACCACAGAAATTCGTGGCGAGCAAATGCAGAT
GCTGGACTCTGGTCGTCAGCAAGGTGAGCAGGGCGATAATGGTTTTAGCCAGCCACGTTTTAACAATAACCAGGGCGGTG
GTTATAGCAATAACAACCAGGGTGGCTATGCGCCGCAAGCTCAAGGCGGTTTTAACAACAATAATGCTGGTGGTGGCTAT
GGCAACCAGGGCGGTTATCAGCAACCGAAACCAGCTCCTGCTGCAACGCCTGCACCGGCAGATTTGGATGATGACTTACC
GTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
51.546 |
100 |
0.532 |
| ssb | Vibrio cholerae strain A1552 |
43.939 |
100 |
0.463 |
| ssb | Neisseria meningitidis MC58 |
38.421 |
100 |
0.388 |
| ssb | Neisseria gonorrhoeae MS11 |
38.421 |
100 |
0.388 |