Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   F7V86_RS19500 Genome accession   NZ_CP044444
Coordinates   3873350..3873727 (-) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain KC41     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3868350..3878727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F7V86_RS19460 - 3868847..3869641 (+) 795 WP_014305407.1 YqhG family protein -
  F7V86_RS19465 sinI 3869818..3869991 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  F7V86_RS19470 sinR 3870025..3870360 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  F7V86_RS19475 tasA 3870408..3871193 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  F7V86_RS19480 sipW 3871258..3871842 (-) 585 WP_012117977.1 signal peptidase I SipW -
  F7V86_RS19485 tapA 3871814..3872485 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  F7V86_RS19490 - 3872744..3873073 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  F7V86_RS19495 - 3873114..3873293 (-) 180 WP_003153093.1 YqzE family protein -
  F7V86_RS19500 comGG 3873350..3873727 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  F7V86_RS19505 comGF 3873728..3874123 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  F7V86_RS19510 comGE 3874137..3874451 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  F7V86_RS19515 comGD 3874435..3874872 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  F7V86_RS19520 comGC 3874862..3875170 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  F7V86_RS19525 comGB 3875175..3876212 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  F7V86_RS19530 comGA 3876199..3877269 (-) 1071 WP_106067891.1 competence type IV pilus ATPase ComGA Machinery gene
  F7V86_RS19535 - 3877461..3878411 (-) 951 WP_151140312.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=390011 F7V86_RS19500 WP_017418138.1 3873350..3873727(-) (comGG) [Bacillus amyloliquefaciens strain KC41]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=390011 F7V86_RS19500 WP_017418138.1 3873350..3873727(-) (comGG) [Bacillus amyloliquefaciens strain KC41]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment