Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | F7V86_RS19465 | Genome accession | NZ_CP044444 |
| Coordinates | 3869818..3869991 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus amyloliquefaciens strain KC41 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3864818..3874991
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F7V86_RS19450 | gcvT | 3865631..3866731 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| F7V86_RS19455 | - | 3867155..3868825 (+) | 1671 | WP_017418135.1 | DEAD/DEAH box helicase | - |
| F7V86_RS19460 | - | 3868847..3869641 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| F7V86_RS19465 | sinI | 3869818..3869991 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| F7V86_RS19470 | sinR | 3870025..3870360 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| F7V86_RS19475 | tasA | 3870408..3871193 (-) | 786 | WP_017418136.1 | biofilm matrix protein TasA | - |
| F7V86_RS19480 | sipW | 3871258..3871842 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| F7V86_RS19485 | tapA | 3871814..3872485 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| F7V86_RS19490 | - | 3872744..3873073 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| F7V86_RS19495 | - | 3873114..3873293 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| F7V86_RS19500 | comGG | 3873350..3873727 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| F7V86_RS19505 | comGF | 3873728..3874123 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| F7V86_RS19510 | comGE | 3874137..3874451 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| F7V86_RS19515 | comGD | 3874435..3874872 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=390009 F7V86_RS19465 WP_014418369.1 3869818..3869991(+) (sinI) [Bacillus amyloliquefaciens strain KC41]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=390009 F7V86_RS19465 WP_014418369.1 3869818..3869991(+) (sinI) [Bacillus amyloliquefaciens strain KC41]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |