Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   F7V86_RS19465 Genome accession   NZ_CP044444
Coordinates   3869818..3869991 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus amyloliquefaciens strain KC41     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3864818..3874991
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F7V86_RS19450 gcvT 3865631..3866731 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  F7V86_RS19455 - 3867155..3868825 (+) 1671 WP_017418135.1 DEAD/DEAH box helicase -
  F7V86_RS19460 - 3868847..3869641 (+) 795 WP_014305407.1 YqhG family protein -
  F7V86_RS19465 sinI 3869818..3869991 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  F7V86_RS19470 sinR 3870025..3870360 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  F7V86_RS19475 tasA 3870408..3871193 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  F7V86_RS19480 sipW 3871258..3871842 (-) 585 WP_012117977.1 signal peptidase I SipW -
  F7V86_RS19485 tapA 3871814..3872485 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  F7V86_RS19490 - 3872744..3873073 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  F7V86_RS19495 - 3873114..3873293 (-) 180 WP_003153093.1 YqzE family protein -
  F7V86_RS19500 comGG 3873350..3873727 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  F7V86_RS19505 comGF 3873728..3874123 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  F7V86_RS19510 comGE 3874137..3874451 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  F7V86_RS19515 comGD 3874435..3874872 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=390009 F7V86_RS19465 WP_014418369.1 3869818..3869991(+) (sinI) [Bacillus amyloliquefaciens strain KC41]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=390009 F7V86_RS19465 WP_014418369.1 3869818..3869991(+) (sinI) [Bacillus amyloliquefaciens strain KC41]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment