Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   F7R84_RS14250 Genome accession   NZ_CP044436
Coordinates   3044313..3044846 (+) Length   177 a.a.
NCBI ID   WP_104836699.1    Uniprot ID   -
Organism   Proteus mirabilis strain C55     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3008980..3049136 3044313..3044846 within 0


Gene organization within MGE regions


Location: 3008980..3049136
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F7R84_RS13985 (F7R84_14090) - 3008980..3009186 (+) 207 WP_104836668.1 DNA polymerase III subunit theta -
  F7R84_RS20010 (F7R84_14095) - 3009371..3010261 (+) 891 WP_350421986.1 acyltransferase family protein -
  F7R84_RS19795 - 3010321..3012213 (-) 1893 WP_233902360.1 phage head-binding domain-containing protein -
  F7R84_RS14000 (F7R84_14105) - 3012327..3014270 (-) 1944 WP_104836670.1 DNA transfer protein -
  F7R84_RS19800 (F7R84_14110) - 3014255..3015823 (-) 1569 WP_104836873.1 phage DNA ejection protein -
  F7R84_RS14010 (F7R84_14115) - 3015833..3016492 (-) 660 WP_104836671.1 DNA transfer protein -
  F7R84_RS14015 (F7R84_14120) - 3016486..3016947 (-) 462 WP_036976869.1 DUF2824 family protein -
  F7R84_RS14020 (F7R84_14125) - 3016947..3017645 (-) 699 WP_104836672.1 phage tail protein -
  F7R84_RS19925 (F7R84_14130) - 3017645..3019426 (-) 1782 WP_320204293.1 packaged DNA stabilization protein -
  F7R84_RS14035 (F7R84_14140) - 3019398..3019895 (-) 498 WP_104836673.1 packaged DNA stabilization gp4 family protein -
  F7R84_RS14040 (F7R84_14145) - 3019873..3020082 (-) 210 WP_104836674.1 hypothetical protein -
  F7R84_RS14045 (F7R84_14150) - 3020134..3021417 (-) 1284 WP_063108518.1 P22 phage major capsid protein family protein -
  F7R84_RS14050 (F7R84_14155) - 3021417..3022331 (-) 915 WP_104836675.1 scaffolding protein -
  F7R84_RS14055 (F7R84_14160) - 3022346..3024436 (-) 2091 WP_104836676.1 portal protein -
  F7R84_RS14060 (F7R84_14165) - 3024439..3025758 (-) 1320 WP_233902411.1 terminase large subunit -
  F7R84_RS14065 (F7R84_14170) - 3025910..3026401 (-) 492 WP_104836678.1 DNA-packaging protein -
  F7R84_RS14070 (F7R84_14175) - 3026590..3027039 (-) 450 WP_104836679.1 collagen-like protein -
  F7R84_RS14075 (F7R84_14180) - 3027049..3027273 (-) 225 WP_036977151.1 DUF2560 family protein -
  F7R84_RS14080 (F7R84_14185) - 3027621..3027986 (-) 366 WP_036976897.1 hypothetical protein -
  F7R84_RS14085 (F7R84_14190) - 3027986..3028393 (-) 408 WP_407027437.1 lysis protein -
  F7R84_RS14090 (F7R84_14195) - 3028435..3028839 (-) 405 WP_104836681.1 structural protein -
  F7R84_RS14095 (F7R84_14200) - 3028832..3029119 (-) 288 WP_104836682.1 phage holin family protein -
  F7R84_RS14100 (F7R84_14205) - 3029116..3029505 (-) 390 WP_004916901.1 putative holin -
  F7R84_RS14105 (F7R84_14210) - 3029990..3030745 (-) 756 WP_104836683.1 antitermination protein -
  F7R84_RS14110 (F7R84_14215) - 3030742..3030933 (-) 192 WP_063693385.1 hypothetical protein -
  F7R84_RS14115 (F7R84_14220) - 3030933..3031553 (-) 621 WP_104836684.1 recombination protein NinG -
  F7R84_RS14120 - 3031557..3031715 (-) 159 WP_158660329.1 hypothetical protein -
  F7R84_RS14125 (F7R84_14225) - 3031827..3032270 (-) 444 WP_104836685.1 recombination protein NinB -
  F7R84_RS14130 (F7R84_14230) - 3032272..3032481 (-) 210 WP_071233478.1 DUF7279 family protein -
  F7R84_RS14140 (F7R84_14240) - 3032650..3032874 (-) 225 WP_071233638.1 DUF551 domain-containing protein -
  F7R84_RS14145 (F7R84_14245) - 3032874..3033086 (-) 213 WP_237731540.1 MarR family transcriptional regulator -
  F7R84_RS14150 (F7R84_14250) - 3033086..3033310 (-) 225 WP_202719664.1 hypothetical protein -
  F7R84_RS14155 - 3033323..3033490 (-) 168 WP_152964332.1 hypothetical protein -
  F7R84_RS14160 (F7R84_14255) rdgC 3033510..3034421 (-) 912 WP_063108498.1 recombination-associated protein RdgC -
  F7R84_RS14165 (F7R84_14260) - 3034432..3035118 (-) 687 WP_104836688.1 replication protein P -
  F7R84_RS14170 (F7R84_14265) - 3035115..3036053 (-) 939 WP_104836689.1 replication protein -
  F7R84_RS14175 (F7R84_14270) - 3036050..3036733 (-) 684 WP_104836690.1 phage antirepressor KilAC domain-containing protein -
  F7R84_RS14180 (F7R84_14275) - 3036755..3037099 (-) 345 WP_104836691.1 hypothetical protein -
  F7R84_RS14185 (F7R84_14280) - 3037235..3037420 (-) 186 WP_036895075.1 Cro/CI family transcriptional regulator -
  F7R84_RS14190 (F7R84_14285) - 3037516..3038226 (+) 711 WP_036976930.1 LexA family protein -
  F7R84_RS14195 (F7R84_14290) - 3038467..3039384 (+) 918 WP_064497308.1 SDH family Clp fold serine proteinase -
  F7R84_RS14200 (F7R84_14295) - 3039936..3040205 (+) 270 WP_104836692.1 hypothetical protein -
  F7R84_RS14205 (F7R84_14300) - 3040221..3040709 (-) 489 WP_158660331.1 hypothetical protein -
  F7R84_RS14210 (F7R84_14305) - 3041164..3041397 (+) 234 WP_104836694.1 hypothetical protein -
  F7R84_RS14215 (F7R84_14310) - 3041399..3041698 (+) 300 WP_104836695.1 hypothetical protein -
  F7R84_RS14220 (F7R84_14315) - 3041767..3042027 (+) 261 WP_004247709.1 hypothetical protein -
  F7R84_RS14225 - 3042082..3042237 (+) 156 WP_170110775.1 hypothetical protein -
  F7R84_RS14230 (F7R84_14320) - 3042245..3042499 (+) 255 WP_104836696.1 hypothetical protein -
  F7R84_RS14235 (F7R84_14325) - 3042496..3042747 (+) 252 WP_004247464.1 hypothetical protein -
  F7R84_RS14240 (F7R84_14330) - 3042744..3043628 (+) 885 WP_104836697.1 RecT family recombinase -
  F7R84_RS14245 (F7R84_14335) - 3043625..3044323 (+) 699 WP_104836698.1 lambda exonuclease family protein -
  F7R84_RS14250 (F7R84_14340) ssb 3044313..3044846 (+) 534 WP_104836699.1 single-stranded DNA-binding protein Machinery gene
  F7R84_RS14255 (F7R84_14345) - 3044862..3045170 (+) 309 WP_104836700.1 hypothetical protein -
  F7R84_RS14260 - 3045211..3045393 (+) 183 WP_046334496.1 hypothetical protein -
  F7R84_RS14265 (F7R84_14355) - 3045432..3045614 (+) 183 WP_063691749.1 hypothetical protein -
  F7R84_RS14270 (F7R84_14360) - 3045607..3045900 (+) 294 WP_104836701.1 hypothetical protein -
  F7R84_RS14275 - 3045900..3046058 (+) 159 WP_158660332.1 hypothetical protein -
  F7R84_RS14280 - 3046213..3046374 (+) 162 WP_158660333.1 hypothetical protein -
  F7R84_RS14285 (F7R84_14365) - 3046367..3046684 (+) 318 WP_104836702.1 phage protein NinX family protein -
  F7R84_RS14290 (F7R84_14370) - 3046873..3047475 (+) 603 WP_104836704.1 MT-A70 family methyltransferase -
  F7R84_RS19805 (F7R84_14380) - 3047764..3048096 (+) 333 WP_094959881.1 helix-turn-helix domain-containing protein -
  F7R84_RS14295 (F7R84_14385) - 3047979..3049136 (+) 1158 WP_233902414.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 177 a.a.        Molecular weight: 19449.78 Da        Isoelectric Point: 6.7135

>NTDB_id=389899 F7R84_RS14250 WP_104836699.1 3044313..3044846(+) (ssb) [Proteus mirabilis strain C55]
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWTDQNGQDRYTTEVVVNVGGTMQMLGGRGGQDNAPSQGQGGWGQPQQPQAPKQASNNQTPQSEPPQDWDDPI
PFAPIGLPYPRHAIYVI

Nucleotide


Download         Length: 534 bp        

>NTDB_id=389899 F7R84_RS14250 WP_104836699.1 3044313..3044846(+) (ssb) [Proteus mirabilis strain C55]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTTATTGGTCACTTGGGGCAGGATCCAGAAATCCGTTATATGCCATCAGG
TGGCGCAGTCGCTAATCTCACACTAGCCACATCGGAATCGTGGCGTGACAAGCAGACTGGTGAGATGAAGGAGAAAACTG
AGTGGCATCGAGTGTGCATCTTCGGAAAATTAGCAGAAATTGCAGGTGAATATCTGAGAAAAGGCTCACAGGTATACATA
GAAGGCTCTCTGCAAACCAGAAAATGGACTGACCAGAACGGACAGGACCGATACACAACGGAAGTAGTGGTTAATGTCGG
TGGCACAATGCAGATGTTAGGTGGCCGTGGTGGTCAAGATAATGCACCTTCACAAGGCCAAGGCGGTTGGGGCCAGCCTC
AGCAACCACAAGCACCAAAACAAGCATCGAATAATCAAACACCGCAAAGTGAACCTCCTCAAGATTGGGATGATCCTATA
CCTTTTGCCCCTATCGGACTCCCCTACCCACGCCACGCTATTTATGTGATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

67.797

100

0.678

  ssb Glaesserella parasuis strain SC1401

49.733

100

0.525

  ssb Neisseria gonorrhoeae MS11

44.318

99.435

0.441

  ssb Neisseria meningitidis MC58

42.373

100

0.424


Multiple sequence alignment