Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | F7R84_RS05165 | Genome accession | NZ_CP044436 |
| Coordinates | 1110068..1110577 (-) | Length | 169 a.a. |
| NCBI ID | WP_017827452.1 | Uniprot ID | - |
| Organism | Proteus mirabilis strain C55 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1106947..1159909 | 1110068..1110577 | within | 0 |
Gene organization within MGE regions
Location: 1106947..1159909
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F7R84_RS05140 (F7R84_05180) | - | 1106947..1107948 (-) | 1002 | WP_159241546.1 | tyrosine-type recombinase/integrase | - |
| F7R84_RS05145 (F7R84_05185) | - | 1107905..1108150 (-) | 246 | WP_004246013.1 | excisionase | - |
| F7R84_RS05150 (F7R84_05190) | - | 1108185..1108787 (-) | 603 | Protein_976 | MT-A70 family methyltransferase | - |
| F7R84_RS19650 (F7R84_05195) | - | 1108784..1109257 (-) | 474 | Protein_977 | SAM-dependent methyltransferase | - |
| F7R84_RS05160 (F7R84_05200) | - | 1109316..1109996 (-) | 681 | WP_168725584.1 | hypothetical protein | - |
| F7R84_RS05165 (F7R84_05205) | ssb | 1110068..1110577 (-) | 510 | WP_017827452.1 | single-stranded DNA-binding protein | Machinery gene |
| F7R84_RS05170 (F7R84_05210) | - | 1110577..1111188 (-) | 612 | WP_017827451.1 | ERF family protein | - |
| F7R84_RS05175 (F7R84_05215) | - | 1111190..1111510 (-) | 321 | WP_017628824.1 | hypothetical protein | - |
| F7R84_RS05180 | - | 1111507..1111659 (-) | 153 | WP_017628823.1 | hypothetical protein | - |
| F7R84_RS05185 (F7R84_05220) | - | 1111656..1111919 (-) | 264 | WP_036919938.1 | hypothetical protein | - |
| F7R84_RS05190 | - | 1111927..1112082 (-) | 156 | WP_165439118.1 | hypothetical protein | - |
| F7R84_RS05195 (F7R84_05225) | - | 1112136..1112396 (-) | 261 | WP_036919939.1 | hypothetical protein | - |
| F7R84_RS05200 (F7R84_05230) | - | 1112596..1113093 (+) | 498 | WP_017628819.1 | hypothetical protein | - |
| F7R84_RS05205 (F7R84_05235) | - | 1113115..1113432 (-) | 318 | WP_004245994.1 | hypothetical protein | - |
| F7R84_RS05210 (F7R84_05240) | - | 1113887..1114252 (-) | 366 | WP_036908285.1 | hypothetical protein | - |
| F7R84_RS05215 (F7R84_05245) | - | 1114249..1115028 (-) | 780 | WP_036908283.1 | hypothetical protein | - |
| F7R84_RS05220 (F7R84_05250) | - | 1115063..1115707 (-) | 645 | WP_036908281.1 | LexA family protein | - |
| F7R84_RS05225 (F7R84_05255) | - | 1115813..1116022 (+) | 210 | WP_004247477.1 | helix-turn-helix transcriptional regulator | - |
| F7R84_RS05230 (F7R84_05260) | - | 1116168..1116515 (+) | 348 | WP_049256531.1 | hypothetical protein | - |
| F7R84_RS05235 | - | 1116611..1116784 (+) | 174 | WP_004251793.1 | hypothetical protein | - |
| F7R84_RS05240 (F7R84_05265) | - | 1116781..1117548 (+) | 768 | WP_036895070.1 | helix-turn-helix domain-containing protein | - |
| F7R84_RS05245 (F7R84_05270) | - | 1117548..1118933 (+) | 1386 | WP_017628813.1 | replicative DNA helicase | - |
| F7R84_RS05250 (F7R84_05275) | - | 1118955..1119290 (+) | 336 | WP_081215064.1 | hypothetical protein | - |
| F7R84_RS05255 (F7R84_05280) | - | 1119358..1119807 (+) | 450 | WP_036919942.1 | YbcN family protein | - |
| F7R84_RS05260 (F7R84_05285) | - | 1119886..1120176 (+) | 291 | WP_004245984.1 | DUF1364 domain-containing protein | - |
| F7R84_RS05265 (F7R84_05290) | - | 1120173..1120529 (+) | 357 | WP_004245983.1 | RusA family crossover junction endodeoxyribonuclease | - |
| F7R84_RS05270 (F7R84_05295) | - | 1120529..1121161 (+) | 633 | WP_004245982.1 | bacteriophage antitermination protein Q | - |
| F7R84_RS05275 (F7R84_05300) | - | 1121473..1121994 (+) | 522 | WP_004247148.1 | YagU family protein | - |
| F7R84_RS05280 (F7R84_05305) | - | 1122153..1122575 (+) | 423 | WP_060555895.1 | hypothetical protein | - |
| F7R84_RS05285 (F7R84_05310) | - | 1122629..1122898 (+) | 270 | WP_004247489.1 | hypothetical protein | - |
| F7R84_RS05290 (F7R84_05315) | - | 1122898..1123368 (+) | 471 | WP_017628809.1 | lysozyme | - |
| F7R84_RS05295 | - | 1123350..1123508 (+) | 159 | WP_012367623.1 | hypothetical protein | - |
| F7R84_RS05300 (F7R84_05320) | - | 1123511..1123972 (+) | 462 | WP_012367624.1 | lysis protein | - |
| F7R84_RS05305 (F7R84_05325) | - | 1124320..1124904 (+) | 585 | WP_004247494.1 | BRO-N domain-containing protein | - |
| F7R84_RS05315 | - | 1125104..1125262 (+) | 159 | WP_004245978.1 | hypothetical protein | - |
| F7R84_RS05320 (F7R84_05335) | - | 1125296..1125898 (+) | 603 | WP_017628804.1 | hypothetical protein | - |
| F7R84_RS05325 (F7R84_05340) | - | 1125901..1127385 (+) | 1485 | WP_134940265.1 | terminase | - |
| F7R84_RS05330 (F7R84_05345) | - | 1127447..1128763 (+) | 1317 | WP_237731546.1 | DUF4055 domain-containing protein | - |
| F7R84_RS05335 (F7R84_05350) | - | 1128772..1129836 (+) | 1065 | WP_017628801.1 | minor capsid protein | - |
| F7R84_RS05340 (F7R84_05355) | - | 1129911..1130597 (+) | 687 | WP_017628800.1 | hypothetical protein | - |
| F7R84_RS05345 (F7R84_05360) | - | 1130603..1131553 (+) | 951 | WP_017827430.1 | major capsid protein | - |
| F7R84_RS05350 (F7R84_05365) | - | 1131596..1131973 (+) | 378 | WP_017628798.1 | DUF7370 family protein | - |
| F7R84_RS05355 (F7R84_05370) | - | 1131975..1132316 (+) | 342 | WP_017628797.1 | hypothetical protein | - |
| F7R84_RS05360 (F7R84_05375) | - | 1132319..1132687 (+) | 369 | WP_017628796.1 | hypothetical protein | - |
| F7R84_RS05365 (F7R84_05380) | - | 1132684..1133055 (+) | 372 | WP_017628795.1 | hypothetical protein | - |
| F7R84_RS05370 (F7R84_05385) | - | 1133120..1133875 (+) | 756 | WP_026164642.1 | Ig-like domain-containing protein | - |
| F7R84_RS05375 (F7R84_05390) | - | 1133925..1134617 (+) | 693 | WP_202719677.1 | DUF6246 family protein | - |
| F7R84_RS05380 (F7R84_05395) | - | 1134778..1135767 (+) | 990 | WP_017827424.1 | P63C domain-containing protein | - |
| F7R84_RS05385 (F7R84_05400) | - | 1135890..1136663 (-) | 774 | WP_017827423.1 | LexA family protein | - |
| F7R84_RS05390 | - | 1136765..1136935 (+) | 171 | WP_017827422.1 | hypothetical protein | - |
| F7R84_RS19655 | - | 1137010..1137639 (+) | 630 | WP_017827421.1 | ORF6N domain-containing protein | - |
| F7R84_RS05400 (F7R84_05410) | - | 1137706..1138431 (+) | 726 | WP_017827420.1 | hypothetical protein | - |
| F7R84_RS05405 (F7R84_05415) | - | 1138668..1139870 (+) | 1203 | WP_017827419.1 | nucleoid-associated protein | - |
| F7R84_RS05410 (F7R84_05420) | - | 1139871..1141019 (+) | 1149 | WP_017827418.1 | hypothetical protein | - |
| F7R84_RS05415 (F7R84_05425) | - | 1141122..1141430 (+) | 309 | WP_017827417.1 | hypothetical protein | - |
| F7R84_RS05420 (F7R84_05430) | - | 1141495..1144830 (+) | 3336 | WP_017827416.1 | tape measure protein | - |
| F7R84_RS05425 (F7R84_05435) | - | 1144846..1145046 (+) | 201 | WP_017827415.1 | hypothetical protein | - |
| F7R84_RS05430 (F7R84_05440) | - | 1145048..1145359 (-) | 312 | WP_017827414.1 | hypothetical protein | - |
| F7R84_RS05435 (F7R84_05445) | - | 1145503..1145832 (+) | 330 | WP_202719678.1 | phage tail protein | - |
| F7R84_RS05440 (F7R84_05450) | - | 1145829..1146527 (+) | 699 | WP_017827413.1 | phage minor tail protein L | - |
| F7R84_RS05445 (F7R84_05455) | - | 1146531..1147250 (+) | 720 | WP_017827412.1 | C40 family peptidase | - |
| F7R84_RS05450 (F7R84_05460) | - | 1147187..1147753 (+) | 567 | WP_017628780.1 | MoaD/ThiS family protein | - |
| F7R84_RS05455 (F7R84_05465) | gpJ | 1147753..1151898 (+) | 4146 | WP_168725586.1 | TipJ family phage tail tip protein | - |
| F7R84_RS05460 (F7R84_05470) | - | 1151898..1152260 (+) | 363 | WP_004247521.1 | hypothetical protein | - |
| F7R84_RS05465 (F7R84_05475) | - | 1152262..1152876 (+) | 615 | WP_004247523.1 | hypothetical protein | - |
| F7R84_RS05470 (F7R84_05480) | - | 1152926..1153186 (+) | 261 | WP_004247524.1 | hypothetical protein | - |
| F7R84_RS05475 (F7R84_05490) | - | 1153897..1154202 (-) | 306 | WP_004247526.1 | helix-turn-helix domain-containing protein | - |
| F7R84_RS05480 (F7R84_05495) | - | 1154303..1155385 (-) | 1083 | WP_159262577.1 | fimbrial protein | - |
| F7R84_RS05485 (F7R84_05500) | - | 1155395..1157929 (-) | 2535 | WP_062814377.1 | fimbria/pilus outer membrane usher protein | - |
| F7R84_RS05490 (F7R84_05505) | - | 1157939..1158664 (-) | 726 | WP_012367650.1 | molecular chaperone | - |
| F7R84_RS05495 (F7R84_05510) | ucaA | 1158730..1159275 (-) | 546 | WP_012367651.1 | uroepithelial cell adherence major pilin UcaA | - |
| F7R84_RS05500 (F7R84_05515) | - | 1159772..1159909 (-) | 138 | Protein_1045 | DNA polymerase III subunit theta | - |
Sequence
Protein
Download Length: 169 a.a. Molecular weight: 19066.43 Da Isoelectric Point: 6.9903
>NTDB_id=389894 F7R84_RS05165 WP_017827452.1 1110068..1110577(-) (ssb) [Proteus mirabilis strain C55]
MASKGVNKVLLIGHLGQDPEMRYLPNGDAVTNITLATSDSWKDKQSGETKERVEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQNGQDRYSTEVVVNINGSMQILGNNNQAGSQKSQPSPHQHGWSLQQSPKRNEPPMDFDDDIPFAPIGLM
YPRHLINII
MASKGVNKVLLIGHLGQDPEMRYLPNGDAVTNITLATSDSWKDKQSGETKERVEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQNGQDRYSTEVVVNINGSMQILGNNNQAGSQKSQPSPHQHGWSLQQSPKRNEPPMDFDDDIPFAPIGLM
YPRHLINII
Nucleotide
Download Length: 510 bp
>NTDB_id=389894 F7R84_RS05165 WP_017827452.1 1110068..1110577(-) (ssb) [Proteus mirabilis strain C55]
ATGGCAAGTAAAGGTGTAAACAAAGTCTTATTGATAGGACATCTAGGTCAAGATCCTGAAATGCGTTACCTCCCAAATGG
CGATGCAGTTACTAATATTACATTAGCCACCAGCGATTCATGGAAAGATAAACAATCAGGTGAAACCAAGGAACGTGTCG
AATGGCATAGAGTTGTGATATTTGGAAAGCTCGCCGAAATTGCTGGCGAATATCTGCGTAAAGGTTCACAAGTCTATATC
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAATGGACAAGACAGATACAGCACGGAAGTTGTAGTGAATATTAA
TGGCTCAATGCAAATTTTAGGTAACAACAATCAGGCTGGTAGCCAGAAATCACAACCATCACCTCATCAACACGGATGGA
GCCTTCAACAATCTCCTAAGCGTAATGAACCTCCAATGGATTTTGATGATGATATTCCTTTTGCGCCGATTGGGCTTATG
TATCCACGACATTTGATTAATATAATTTAG
ATGGCAAGTAAAGGTGTAAACAAAGTCTTATTGATAGGACATCTAGGTCAAGATCCTGAAATGCGTTACCTCCCAAATGG
CGATGCAGTTACTAATATTACATTAGCCACCAGCGATTCATGGAAAGATAAACAATCAGGTGAAACCAAGGAACGTGTCG
AATGGCATAGAGTTGTGATATTTGGAAAGCTCGCCGAAATTGCTGGCGAATATCTGCGTAAAGGTTCACAAGTCTATATC
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAATGGACAAGACAGATACAGCACGGAAGTTGTAGTGAATATTAA
TGGCTCAATGCAAATTTTAGGTAACAACAATCAGGCTGGTAGCCAGAAATCACAACCATCACCTCATCAACACGGATGGA
GCCTTCAACAATCTCCTAAGCGTAATGAACCTCCAATGGATTTTGATGATGATATTCCTTTTGCGCCGATTGGGCTTATG
TATCCACGACATTTGATTAATATAATTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
63.277 |
100 |
0.663 |
| ssb | Glaesserella parasuis strain SC1401 |
47.753 |
100 |
0.503 |
| ssb | Neisseria gonorrhoeae MS11 |
42.045 |
100 |
0.438 |
| ssb | Neisseria meningitidis MC58 |
42.045 |
100 |
0.438 |