Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | F1614_RS03945 | Genome accession | NZ_CP043847 |
| Coordinates | 850204..850668 (-) | Length | 154 a.a. |
| NCBI ID | WP_017464434.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain NCCP 16828 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 818145..863081 | 850204..850668 | within | 0 |
Gene organization within MGE regions
Location: 818145..863081
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F1614_RS03740 (F1614_03765) | - | 818145..818702 (-) | 558 | WP_001831688.1 | GNAT family N-acetyltransferase | - |
| F1614_RS03750 (F1614_03775) | - | 818932..819147 (+) | 216 | WP_017465195.1 | TM2 domain-containing protein | - |
| F1614_RS12960 | - | 819250..819366 (+) | 117 | WP_353954719.1 | SAR1012 family small protein | - |
| F1614_RS03755 (F1614_03780) | - | 819625..820356 (+) | 732 | WP_158171979.1 | halocin C8 precursor-like protein | - |
| F1614_RS12900 (F1614_03800) | - | 822420..823883 (-) | 1464 | Protein_725 | SH3 domain-containing protein | - |
| F1614_RS03775 (F1614_03805) | - | 823858..824268 (-) | 411 | WP_017464465.1 | phage holin | - |
| F1614_RS03780 (F1614_03810) | - | 824332..824730 (-) | 399 | WP_017464464.1 | YxeA family protein | - |
| F1614_RS03785 (F1614_03815) | - | 824888..825295 (-) | 408 | WP_002499222.1 | hypothetical protein | - |
| F1614_RS03790 (F1614_03820) | - | 825282..825707 (-) | 426 | WP_158171757.1 | hypothetical protein | - |
| F1614_RS03795 (F1614_03825) | - | 825704..826327 (-) | 624 | WP_029376548.1 | poly-gamma-glutamate hydrolase family protein | - |
| F1614_RS03800 (F1614_03830) | - | 826332..827546 (-) | 1215 | WP_017464460.1 | BppU family phage baseplate upper protein | - |
| F1614_RS03805 (F1614_03835) | - | 827546..829408 (-) | 1863 | WP_158171758.1 | M14 family metallopeptidase | - |
| F1614_RS12530 | - | 829424..829597 (-) | 174 | WP_017464458.1 | hypothetical protein | - |
| F1614_RS03810 (F1614_03840) | - | 829590..831149 (-) | 1560 | WP_199253294.1 | prophage endopeptidase tail family protein | - |
| F1614_RS03815 (F1614_03845) | - | 831159..831992 (-) | 834 | WP_017464456.1 | phage tail domain-containing protein | - |
| F1614_RS03820 (F1614_03850) | - | 831994..836490 (-) | 4497 | WP_158171760.1 | tape measure protein | - |
| F1614_RS03825 | gpGT | 836519..836671 (-) | 153 | WP_157781582.1 | phage tail assembly chaperone GT | - |
| F1614_RS03830 (F1614_03855) | gpG | 836704..837066 (-) | 363 | WP_002499232.1 | phage tail assembly chaperone G | - |
| F1614_RS03835 (F1614_03860) | - | 837130..837315 (-) | 186 | WP_002499233.1 | hypothetical protein | - |
| F1614_RS03840 (F1614_03865) | - | 837334..837960 (-) | 627 | WP_017464454.1 | major tail protein | - |
| F1614_RS03845 (F1614_03870) | - | 837973..838377 (-) | 405 | WP_017464453.1 | hypothetical protein | - |
| F1614_RS03850 (F1614_03875) | - | 838380..838667 (-) | 288 | WP_002499236.1 | hypothetical protein | - |
| F1614_RS03855 (F1614_03880) | - | 838781..839110 (-) | 330 | WP_002484730.1 | hypothetical protein | - |
| F1614_RS03860 (F1614_03885) | - | 839100..839441 (-) | 342 | WP_017464452.1 | head-tail connector protein | - |
| F1614_RS03865 (F1614_03890) | - | 839460..840797 (-) | 1338 | WP_059279869.1 | phage major capsid protein | - |
| F1614_RS03870 (F1614_03895) | - | 840839..841396 (-) | 558 | WP_017464449.1 | HK97 family phage prohead protease | - |
| F1614_RS03875 (F1614_03900) | - | 841383..842618 (-) | 1236 | WP_017464448.1 | phage portal protein | - |
| F1614_RS03880 (F1614_03905) | - | 842618..842812 (-) | 195 | WP_017464447.1 | hypothetical protein | - |
| F1614_RS03885 (F1614_03910) | - | 842824..844575 (-) | 1752 | Protein_749 | terminase large subunit | - |
| F1614_RS03890 (F1614_03915) | - | 844568..845053 (-) | 486 | WP_017464445.1 | phage terminase small subunit P27 family | - |
| F1614_RS03895 (F1614_03920) | - | 845213..845563 (-) | 351 | WP_017464444.1 | HNH endonuclease | - |
| F1614_RS03900 (F1614_03925) | - | 846045..846491 (-) | 447 | WP_002502054.1 | transcriptional regulator | - |
| F1614_RS12965 (F1614_03930) | - | 846504..846659 (-) | 156 | WP_017464443.1 | DUF1514 domain-containing protein | - |
| F1614_RS03905 (F1614_03940) | - | 846852..847154 (+) | 303 | WP_017464442.1 | DUF4870 domain-containing protein | - |
| F1614_RS03910 (F1614_03945) | - | 847251..847556 (-) | 306 | WP_017464441.1 | MazG-like family protein | - |
| F1614_RS03915 (F1614_03950) | - | 847624..848334 (+) | 711 | WP_017464440.1 | post-transcriptional regulator | - |
| F1614_RS03920 (F1614_03955) | - | 848316..848498 (-) | 183 | WP_017464439.1 | hypothetical protein | - |
| F1614_RS03925 (F1614_03960) | - | 848500..848847 (-) | 348 | WP_017464438.1 | hypothetical protein | - |
| F1614_RS03930 (F1614_03965) | - | 848870..849757 (-) | 888 | WP_158171761.1 | DnaD domain-containing protein | - |
| F1614_RS03935 (F1614_03970) | - | 849792..849989 (-) | 198 | WP_017464436.1 | helix-turn-helix domain-containing protein | - |
| F1614_RS03940 (F1614_03975) | - | 849986..850189 (-) | 204 | WP_017464435.1 | helix-turn-helix domain-containing protein | - |
| F1614_RS03945 (F1614_03980) | ssbA | 850204..850668 (-) | 465 | WP_017464434.1 | single-stranded DNA-binding protein | Machinery gene |
| F1614_RS03950 (F1614_03985) | - | 850669..851286 (-) | 618 | WP_158171980.1 | MBL fold metallo-hydrolase | - |
| F1614_RS03955 (F1614_03990) | - | 851367..852290 (-) | 924 | WP_017464432.1 | recombinase RecT | - |
| F1614_RS03960 (F1614_03995) | - | 852292..854241 (-) | 1950 | WP_158171762.1 | AAA family ATPase | - |
| F1614_RS03965 (F1614_04000) | - | 854244..854507 (-) | 264 | WP_002499256.1 | hypothetical protein | - |
| F1614_RS03970 (F1614_04005) | - | 854577..854768 (-) | 192 | WP_017464430.1 | DUF1270 family protein | - |
| F1614_RS03975 (F1614_04010) | - | 854879..855160 (+) | 282 | WP_002502040.1 | hypothetical protein | - |
| F1614_RS12535 | - | 855157..855303 (-) | 147 | WP_002502039.1 | hypothetical protein | - |
| F1614_RS03980 (F1614_04015) | - | 855319..855528 (-) | 210 | WP_158171763.1 | hypothetical protein | - |
| F1614_RS03985 (F1614_04020) | - | 855586..855924 (+) | 339 | WP_002499261.1 | hypothetical protein | - |
| F1614_RS03990 (F1614_04025) | - | 855910..856143 (-) | 234 | WP_002499262.1 | MW1434 family type I TA system toxin | - |
| F1614_RS03995 (F1614_04030) | - | 856159..856914 (-) | 756 | WP_049372322.1 | phage antirepressor KilAC domain-containing protein | - |
| F1614_RS04000 (F1614_04035) | - | 856965..857519 (+) | 555 | WP_017464429.1 | hypothetical protein | - |
| F1614_RS12540 | - | 857526..857663 (-) | 138 | WP_017464428.1 | hypothetical protein | - |
| F1614_RS04005 (F1614_04040) | - | 857679..857894 (-) | 216 | WP_017464427.1 | hypothetical protein | - |
| F1614_RS04010 (F1614_04045) | - | 858091..858717 (+) | 627 | WP_158171764.1 | LexA family transcriptional regulator | - |
| F1614_RS12545 | - | 858762..858929 (+) | 168 | WP_017464425.1 | hypothetical protein | - |
| F1614_RS04015 (F1614_04050) | - | 858933..860090 (+) | 1158 | WP_017464424.1 | CapA family protein | - |
| F1614_RS04020 (F1614_04055) | - | 860299..860967 (+) | 669 | WP_002500136.1 | hypothetical protein | - |
| F1614_RS04025 (F1614_04060) | - | 861091..861612 (+) | 522 | WP_002500137.1 | hypothetical protein | - |
| F1614_RS04030 (F1614_04065) | - | 861605..861976 (+) | 372 | WP_002500138.1 | hypothetical protein | - |
| F1614_RS04035 (F1614_04070) | - | 862032..863081 (+) | 1050 | WP_002500139.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 154 a.a. Molecular weight: 17233.98 Da Isoelectric Point: 7.0155
>NTDB_id=386241 F1614_RS03945 WP_017464434.1 850204..850668(-) (ssbA) [Staphylococcus epidermidis strain NCCP 16828]
MINRAVLIGRLTKDPEFRTTQSGIDVATFTLAVNRNFTNAQGEREADFINIIVFRKQAHNVNNYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNSNGSQQDTYQQQAQSQTQRGQNTKPQGQNPFANANGPIDISDDDLPF
MINRAVLIGRLTKDPEFRTTQSGIDVATFTLAVNRNFTNAQGEREADFINIIVFRKQAHNVNNYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNSNGSQQDTYQQQAQSQTQRGQNTKPQGQNPFANANGPIDISDDDLPF
Nucleotide
Download Length: 465 bp
>NTDB_id=386241 F1614_RS03945 WP_017464434.1 850204..850668(-) (ssbA) [Staphylococcus epidermidis strain NCCP 16828]
ATGATTAACAGAGCAGTATTAATAGGTCGTTTAACTAAAGATCCTGAATTTAGAACAACTCAAAGTGGAATTGATGTTGC
AACTTTCACACTAGCAGTTAATCGTAATTTCACAAACGCACAGGGCGAACGTGAAGCAGATTTTATCAATATTATCGTAT
TTAGAAAACAAGCACACAATGTTAACAACTATTTATCGAAAGGAAAATTAGCAGGCGTTGATGGTCGCATACAATCACGC
AGTTATGAAAATCAAGAAGGTCGTCGAATATTTGTGACTGAAGTAGTTGCAGATAGCGTCCAATTTCTTGAACCTAAAAA
CTCAAATGGTAGCCAACAAGACACTTACCAGCAACAAGCTCAATCACAAACACAACGTGGCCAAAATACTAAACCACAAG
GACAAAATCCTTTCGCAAATGCTAATGGTCCAATTGATATCAGTGATGATGATTTACCGTTTTAA
ATGATTAACAGAGCAGTATTAATAGGTCGTTTAACTAAAGATCCTGAATTTAGAACAACTCAAAGTGGAATTGATGTTGC
AACTTTCACACTAGCAGTTAATCGTAATTTCACAAACGCACAGGGCGAACGTGAAGCAGATTTTATCAATATTATCGTAT
TTAGAAAACAAGCACACAATGTTAACAACTATTTATCGAAAGGAAAATTAGCAGGCGTTGATGGTCGCATACAATCACGC
AGTTATGAAAATCAAGAAGGTCGTCGAATATTTGTGACTGAAGTAGTTGCAGATAGCGTCCAATTTCTTGAACCTAAAAA
CTCAAATGGTAGCCAACAAGACACTTACCAGCAACAAGCTCAATCACAAACACAACGTGGCCAAAATACTAAACCACAAG
GACAAAATCCTTTCGCAAATGCTAATGGTCCAATTGATATCAGTGATGATGATTTACCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.656 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.419 |
100 |
0.552 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
68.831 |
0.396 |
| ssb | Glaesserella parasuis strain SC1401 |
31.638 |
100 |
0.364 |