Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   F1614_RS03945 Genome accession   NZ_CP043847
Coordinates   850204..850668 (-) Length   154 a.a.
NCBI ID   WP_017464434.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain NCCP 16828     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 818145..863081 850204..850668 within 0


Gene organization within MGE regions


Location: 818145..863081
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F1614_RS03740 (F1614_03765) - 818145..818702 (-) 558 WP_001831688.1 GNAT family N-acetyltransferase -
  F1614_RS03750 (F1614_03775) - 818932..819147 (+) 216 WP_017465195.1 TM2 domain-containing protein -
  F1614_RS12960 - 819250..819366 (+) 117 WP_353954719.1 SAR1012 family small protein -
  F1614_RS03755 (F1614_03780) - 819625..820356 (+) 732 WP_158171979.1 halocin C8 precursor-like protein -
  F1614_RS12900 (F1614_03800) - 822420..823883 (-) 1464 Protein_725 SH3 domain-containing protein -
  F1614_RS03775 (F1614_03805) - 823858..824268 (-) 411 WP_017464465.1 phage holin -
  F1614_RS03780 (F1614_03810) - 824332..824730 (-) 399 WP_017464464.1 YxeA family protein -
  F1614_RS03785 (F1614_03815) - 824888..825295 (-) 408 WP_002499222.1 hypothetical protein -
  F1614_RS03790 (F1614_03820) - 825282..825707 (-) 426 WP_158171757.1 hypothetical protein -
  F1614_RS03795 (F1614_03825) - 825704..826327 (-) 624 WP_029376548.1 poly-gamma-glutamate hydrolase family protein -
  F1614_RS03800 (F1614_03830) - 826332..827546 (-) 1215 WP_017464460.1 BppU family phage baseplate upper protein -
  F1614_RS03805 (F1614_03835) - 827546..829408 (-) 1863 WP_158171758.1 M14 family metallopeptidase -
  F1614_RS12530 - 829424..829597 (-) 174 WP_017464458.1 hypothetical protein -
  F1614_RS03810 (F1614_03840) - 829590..831149 (-) 1560 WP_199253294.1 prophage endopeptidase tail family protein -
  F1614_RS03815 (F1614_03845) - 831159..831992 (-) 834 WP_017464456.1 phage tail domain-containing protein -
  F1614_RS03820 (F1614_03850) - 831994..836490 (-) 4497 WP_158171760.1 tape measure protein -
  F1614_RS03825 gpGT 836519..836671 (-) 153 WP_157781582.1 phage tail assembly chaperone GT -
  F1614_RS03830 (F1614_03855) gpG 836704..837066 (-) 363 WP_002499232.1 phage tail assembly chaperone G -
  F1614_RS03835 (F1614_03860) - 837130..837315 (-) 186 WP_002499233.1 hypothetical protein -
  F1614_RS03840 (F1614_03865) - 837334..837960 (-) 627 WP_017464454.1 major tail protein -
  F1614_RS03845 (F1614_03870) - 837973..838377 (-) 405 WP_017464453.1 hypothetical protein -
  F1614_RS03850 (F1614_03875) - 838380..838667 (-) 288 WP_002499236.1 hypothetical protein -
  F1614_RS03855 (F1614_03880) - 838781..839110 (-) 330 WP_002484730.1 hypothetical protein -
  F1614_RS03860 (F1614_03885) - 839100..839441 (-) 342 WP_017464452.1 head-tail connector protein -
  F1614_RS03865 (F1614_03890) - 839460..840797 (-) 1338 WP_059279869.1 phage major capsid protein -
  F1614_RS03870 (F1614_03895) - 840839..841396 (-) 558 WP_017464449.1 HK97 family phage prohead protease -
  F1614_RS03875 (F1614_03900) - 841383..842618 (-) 1236 WP_017464448.1 phage portal protein -
  F1614_RS03880 (F1614_03905) - 842618..842812 (-) 195 WP_017464447.1 hypothetical protein -
  F1614_RS03885 (F1614_03910) - 842824..844575 (-) 1752 Protein_749 terminase large subunit -
  F1614_RS03890 (F1614_03915) - 844568..845053 (-) 486 WP_017464445.1 phage terminase small subunit P27 family -
  F1614_RS03895 (F1614_03920) - 845213..845563 (-) 351 WP_017464444.1 HNH endonuclease -
  F1614_RS03900 (F1614_03925) - 846045..846491 (-) 447 WP_002502054.1 transcriptional regulator -
  F1614_RS12965 (F1614_03930) - 846504..846659 (-) 156 WP_017464443.1 DUF1514 domain-containing protein -
  F1614_RS03905 (F1614_03940) - 846852..847154 (+) 303 WP_017464442.1 DUF4870 domain-containing protein -
  F1614_RS03910 (F1614_03945) - 847251..847556 (-) 306 WP_017464441.1 MazG-like family protein -
  F1614_RS03915 (F1614_03950) - 847624..848334 (+) 711 WP_017464440.1 post-transcriptional regulator -
  F1614_RS03920 (F1614_03955) - 848316..848498 (-) 183 WP_017464439.1 hypothetical protein -
  F1614_RS03925 (F1614_03960) - 848500..848847 (-) 348 WP_017464438.1 hypothetical protein -
  F1614_RS03930 (F1614_03965) - 848870..849757 (-) 888 WP_158171761.1 DnaD domain-containing protein -
  F1614_RS03935 (F1614_03970) - 849792..849989 (-) 198 WP_017464436.1 helix-turn-helix domain-containing protein -
  F1614_RS03940 (F1614_03975) - 849986..850189 (-) 204 WP_017464435.1 helix-turn-helix domain-containing protein -
  F1614_RS03945 (F1614_03980) ssbA 850204..850668 (-) 465 WP_017464434.1 single-stranded DNA-binding protein Machinery gene
  F1614_RS03950 (F1614_03985) - 850669..851286 (-) 618 WP_158171980.1 MBL fold metallo-hydrolase -
  F1614_RS03955 (F1614_03990) - 851367..852290 (-) 924 WP_017464432.1 recombinase RecT -
  F1614_RS03960 (F1614_03995) - 852292..854241 (-) 1950 WP_158171762.1 AAA family ATPase -
  F1614_RS03965 (F1614_04000) - 854244..854507 (-) 264 WP_002499256.1 hypothetical protein -
  F1614_RS03970 (F1614_04005) - 854577..854768 (-) 192 WP_017464430.1 DUF1270 family protein -
  F1614_RS03975 (F1614_04010) - 854879..855160 (+) 282 WP_002502040.1 hypothetical protein -
  F1614_RS12535 - 855157..855303 (-) 147 WP_002502039.1 hypothetical protein -
  F1614_RS03980 (F1614_04015) - 855319..855528 (-) 210 WP_158171763.1 hypothetical protein -
  F1614_RS03985 (F1614_04020) - 855586..855924 (+) 339 WP_002499261.1 hypothetical protein -
  F1614_RS03990 (F1614_04025) - 855910..856143 (-) 234 WP_002499262.1 MW1434 family type I TA system toxin -
  F1614_RS03995 (F1614_04030) - 856159..856914 (-) 756 WP_049372322.1 phage antirepressor KilAC domain-containing protein -
  F1614_RS04000 (F1614_04035) - 856965..857519 (+) 555 WP_017464429.1 hypothetical protein -
  F1614_RS12540 - 857526..857663 (-) 138 WP_017464428.1 hypothetical protein -
  F1614_RS04005 (F1614_04040) - 857679..857894 (-) 216 WP_017464427.1 hypothetical protein -
  F1614_RS04010 (F1614_04045) - 858091..858717 (+) 627 WP_158171764.1 LexA family transcriptional regulator -
  F1614_RS12545 - 858762..858929 (+) 168 WP_017464425.1 hypothetical protein -
  F1614_RS04015 (F1614_04050) - 858933..860090 (+) 1158 WP_017464424.1 CapA family protein -
  F1614_RS04020 (F1614_04055) - 860299..860967 (+) 669 WP_002500136.1 hypothetical protein -
  F1614_RS04025 (F1614_04060) - 861091..861612 (+) 522 WP_002500137.1 hypothetical protein -
  F1614_RS04030 (F1614_04065) - 861605..861976 (+) 372 WP_002500138.1 hypothetical protein -
  F1614_RS04035 (F1614_04070) - 862032..863081 (+) 1050 WP_002500139.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 154 a.a.        Molecular weight: 17233.98 Da        Isoelectric Point: 7.0155

>NTDB_id=386241 F1614_RS03945 WP_017464434.1 850204..850668(-) (ssbA) [Staphylococcus epidermidis strain NCCP 16828]
MINRAVLIGRLTKDPEFRTTQSGIDVATFTLAVNRNFTNAQGEREADFINIIVFRKQAHNVNNYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNSNGSQQDTYQQQAQSQTQRGQNTKPQGQNPFANANGPIDISDDDLPF

Nucleotide


Download         Length: 465 bp        

>NTDB_id=386241 F1614_RS03945 WP_017464434.1 850204..850668(-) (ssbA) [Staphylococcus epidermidis strain NCCP 16828]
ATGATTAACAGAGCAGTATTAATAGGTCGTTTAACTAAAGATCCTGAATTTAGAACAACTCAAAGTGGAATTGATGTTGC
AACTTTCACACTAGCAGTTAATCGTAATTTCACAAACGCACAGGGCGAACGTGAAGCAGATTTTATCAATATTATCGTAT
TTAGAAAACAAGCACACAATGTTAACAACTATTTATCGAAAGGAAAATTAGCAGGCGTTGATGGTCGCATACAATCACGC
AGTTATGAAAATCAAGAAGGTCGTCGAATATTTGTGACTGAAGTAGTTGCAGATAGCGTCCAATTTCTTGAACCTAAAAA
CTCAAATGGTAGCCAACAAGACACTTACCAGCAACAAGCTCAATCACAAACACAACGTGGCCAAAATACTAAACCACAAG
GACAAAATCCTTTCGCAAATGCTAATGGTCCAATTGATATCAGTGATGATGATTTACCGTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.721

100

0.656

  ssb Latilactobacillus sakei subsp. sakei 23K

49.419

100

0.552

  ssbB Bacillus subtilis subsp. subtilis str. 168

57.547

68.831

0.396

  ssb Glaesserella parasuis strain SC1401

31.638

100

0.364


Multiple sequence alignment