Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | F1612_RS10125 | Genome accession | NZ_CP043843 |
| Coordinates | 2015750..2016220 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934769.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain NCCP 16830 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1984417..2028209 | 2015750..2016220 | within | 0 |
Gene organization within MGE regions
Location: 1984417..2028209
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F1612_RS09905 (F1612_10080) | - | 1984417..1984602 (-) | 186 | WP_001286805.1 | hypothetical protein | - |
| F1612_RS09910 (F1612_10085) | - | 1984604..1984714 (-) | 111 | WP_000139423.1 | hypothetical protein | - |
| F1612_RS09915 (F1612_10090) | - | 1984785..1984937 (-) | 153 | WP_001788502.1 | hypothetical protein | - |
| F1612_RS09920 (F1612_10095) | - | 1985180..1986625 (-) | 1446 | WP_063125000.1 | SH3 domain-containing protein | - |
| F1612_RS09925 (F1612_10100) | - | 1986606..1987043 (-) | 438 | WP_158173010.1 | phage holin | - |
| F1612_RS09930 (F1612_10105) | - | 1987099..1987494 (-) | 396 | WP_000398857.1 | hypothetical protein | - |
| F1612_RS09935 (F1612_10110) | - | 1987499..1988734 (-) | 1236 | WP_158173011.1 | BppU family phage baseplate upper protein | - |
| F1612_RS09940 (F1612_10115) | - | 1988747..1990621 (-) | 1875 | WP_063125003.1 | glucosaminidase domain-containing protein | - |
| F1612_RS09945 (F1612_10120) | - | 1990758..1991057 (-) | 300 | WP_000466777.1 | DUF2951 domain-containing protein | - |
| F1612_RS09950 (F1612_10125) | - | 1991098..1991271 (-) | 174 | WP_000782200.1 | XkdX family protein | - |
| F1612_RS09955 (F1612_10130) | - | 1991275..1991652 (-) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| F1612_RS09960 (F1612_10135) | - | 1991652..1993475 (-) | 1824 | WP_050960853.1 | phage baseplate upper protein | - |
| F1612_RS09965 (F1612_10140) | - | 1993475..1995373 (-) | 1899 | WP_031907811.1 | hypothetical protein | - |
| F1612_RS09970 (F1612_10145) | - | 1995386..1997272 (-) | 1887 | WP_031907812.1 | SGNH/GDSL hydrolase family protein | - |
| F1612_RS09975 (F1612_10150) | - | 1997283..1998218 (-) | 936 | WP_031897669.1 | phage tail domain-containing protein | - |
| F1612_RS09980 (F1612_10155) | - | 1998233..2001202 (-) | 2970 | WP_031921309.1 | terminase | - |
| F1612_RS09985 (F1612_10160) | - | 2001205..2001546 (-) | 342 | WP_025173814.1 | hypothetical protein | - |
| F1612_RS09990 (F1612_10165) | - | 2001567..2002061 (-) | 495 | WP_050960854.1 | tail assembly chaperone | - |
| F1612_RS09995 (F1612_10170) | - | 2002123..2002683 (-) | 561 | WP_000046067.1 | hypothetical protein | - |
| F1612_RS10000 (F1612_10175) | - | 2002670..2003107 (-) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| F1612_RS10005 (F1612_10180) | - | 2003120..2003533 (-) | 414 | WP_001151332.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| F1612_RS10010 (F1612_10185) | - | 2003520..2003855 (-) | 336 | WP_000482986.1 | phage head closure protein | - |
| F1612_RS10015 (F1612_10190) | - | 2003848..2004162 (-) | 315 | WP_000338936.1 | phage head-tail connector protein | - |
| F1612_RS10020 (F1612_10195) | - | 2004162..2004488 (-) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| F1612_RS10025 (F1612_10200) | - | 2004505..2005329 (-) | 825 | WP_001135550.1 | N4-gp56 family major capsid protein | - |
| F1612_RS10030 (F1612_10205) | - | 2005350..2005946 (-) | 597 | WP_000366931.1 | phage scaffolding protein | - |
| F1612_RS10035 (F1612_10210) | - | 2006051..2006257 (-) | 207 | WP_000346033.1 | hypothetical protein | - |
| F1612_RS10040 (F1612_10215) | - | 2006259..2007242 (-) | 984 | WP_049886451.1 | phage head morphogenesis protein | - |
| F1612_RS10045 (F1612_10220) | - | 2007181..2008599 (-) | 1419 | WP_199251062.1 | phage portal protein | - |
| F1612_RS10050 (F1612_10225) | - | 2008613..2009821 (-) | 1209 | WP_031907817.1 | PBSX family phage terminase large subunit | - |
| F1612_RS10055 (F1612_10230) | - | 2009814..2010308 (-) | 495 | WP_050960855.1 | terminase small subunit | - |
| F1612_RS10060 (F1612_10235) | - | 2010659..2011060 (-) | 402 | WP_029550563.1 | hypothetical protein | - |
| F1612_RS10065 (F1612_10240) | rinB | 2011061..2011234 (-) | 174 | WP_000595256.1 | transcriptional activator RinB | - |
| F1612_RS10070 (F1612_10245) | - | 2011231..2011437 (-) | 207 | WP_000195810.1 | DUF1381 domain-containing protein | - |
| F1612_RS10075 (F1612_10250) | - | 2011474..2012010 (-) | 537 | WP_000185669.1 | dUTP diphosphatase | - |
| F1612_RS10080 (F1612_10255) | - | 2012003..2012251 (-) | 249 | WP_001065083.1 | DUF1024 family protein | - |
| F1612_RS10085 (F1612_10260) | - | 2012244..2012528 (-) | 285 | WP_001105621.1 | hypothetical protein | - |
| F1612_RS10090 (F1612_10265) | - | 2012525..2012974 (-) | 450 | WP_000982708.1 | YopX family protein | - |
| F1612_RS14140 (F1612_10270) | - | 2012971..2013165 (-) | 195 | WP_000983954.1 | hypothetical protein | - |
| F1612_RS10095 (F1612_10275) | - | 2013162..2013548 (-) | 387 | WP_000693615.1 | hypothetical protein | - |
| F1612_RS10100 (F1612_10280) | - | 2013562..2013804 (-) | 243 | WP_000131377.1 | phi PVL orf 51-like protein | - |
| F1612_RS10105 (F1612_10285) | - | 2013808..2014176 (-) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| F1612_RS10110 (F1612_10290) | - | 2014189..2014593 (-) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| F1612_RS10115 (F1612_10295) | - | 2014602..2014820 (-) | 219 | WP_158173013.1 | hypothetical protein | - |
| F1612_RS10120 (F1612_10300) | - | 2014827..2015720 (-) | 894 | WP_000148329.1 | DnaD domain protein | - |
| F1612_RS10125 (F1612_10305) | ssbA | 2015750..2016220 (-) | 471 | WP_000934769.1 | single-stranded DNA-binding protein | Machinery gene |
| F1612_RS10130 (F1612_10310) | - | 2016221..2016838 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| F1612_RS10135 (F1612_10315) | - | 2016919..2017839 (-) | 921 | WP_158173014.1 | recombinase RecT | - |
| F1612_RS10140 (F1612_10320) | - | 2017841..2019784 (-) | 1944 | WP_158173015.1 | AAA family ATPase | - |
| F1612_RS10145 (F1612_10325) | - | 2019793..2020056 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| F1612_RS10150 (F1612_10330) | - | 2020065..2020325 (-) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| F1612_RS10155 (F1612_10335) | - | 2020417..2020578 (-) | 162 | WP_158173016.1 | DUF1270 family protein | - |
| F1612_RS10160 (F1612_10340) | - | 2020571..2020792 (-) | 222 | WP_158173017.1 | hypothetical protein | - |
| F1612_RS10165 (F1612_10345) | - | 2020863..2021528 (+) | 666 | WP_158173018.1 | hypothetical protein | - |
| F1612_RS14145 | - | 2021549..2021617 (-) | 69 | Protein_1974 | hypothetical protein | - |
| F1612_RS10170 (F1612_10350) | - | 2021633..2022385 (-) | 753 | WP_001148595.1 | phage antirepressor KilAC domain-containing protein | - |
| F1612_RS10175 (F1612_10355) | - | 2022387..2022572 (-) | 186 | WP_000933363.1 | helix-turn-helix domain-containing protein | - |
| F1612_RS14045 | - | 2023011..2023181 (+) | 171 | WP_001280594.1 | hypothetical protein | - |
| F1612_RS14050 | - | 2023142..2023303 (-) | 162 | WP_199251063.1 | hypothetical protein | - |
| F1612_RS10180 (F1612_10360) | - | 2023318..2023557 (-) | 240 | WP_016187264.1 | helix-turn-helix domain-containing protein | - |
| F1612_RS10185 (F1612_10365) | - | 2023749..2024423 (+) | 675 | WP_000142628.1 | XRE family transcriptional regulator | - |
| F1612_RS10190 (F1612_10370) | - | 2024641..2025162 (+) | 522 | WP_001102445.1 | hypothetical protein | - |
| F1612_RS10195 (F1612_10375) | - | 2025155..2025625 (+) | 471 | WP_000183249.1 | hypothetical protein | - |
| F1612_RS10200 (F1612_10380) | - | 2025695..2026744 (+) | 1050 | WP_158173019.1 | tyrosine-type recombinase/integrase | - |
| F1612_RS10205 (F1612_10385) | sufB | 2026812..2028209 (-) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17671.55 Da Isoelectric Point: 5.2672
>NTDB_id=386181 F1612_RS10125 WP_000934769.1 2015750..2016220(-) (ssbA) [Staphylococcus aureus strain NCCP 16830]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=386181 F1612_RS10125 WP_000934769.1 2015750..2016220(-) (ssbA) [Staphylococcus aureus strain NCCP 16830]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |