Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FQP84_RS09885 | Genome accession | NZ_CP043302 |
| Coordinates | 1917441..1917911 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 16445 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1892361..1948510 | 1917441..1917911 | within | 0 |
Gene organization within MGE regions
Location: 1892361..1948510
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FQP84_RS09715 (FQP84_09715) | groES | 1892361..1892645 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| FQP84_RS09720 (FQP84_09720) | groL | 1892754..1894370 (+) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| FQP84_RS09725 (FQP84_09725) | - | 1894465..1895011 (-) | 547 | Protein_1862 | site-specific integrase | - |
| FQP84_RS09730 (FQP84_09730) | - | 1895072..1895284 (+) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| FQP84_RS09735 (FQP84_09735) | - | 1895281..1895871 (+) | 591 | WP_031806879.1 | terminase small subunit | - |
| FQP84_RS09740 (FQP84_09740) | - | 1896189..1896625 (+) | 437 | Protein_1865 | hypothetical protein | - |
| FQP84_RS09745 (FQP84_09745) | - | 1896731..1897174 (+) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| FQP84_RS09755 (FQP84_09755) | - | 1898027..1899334 (-) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| FQP84_RS09760 (FQP84_09760) | - | 1899495..1900406 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| FQP84_RS09765 (FQP84_09765) | - | 1900468..1901313 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| FQP84_RS09770 (FQP84_09770) | - | 1901685..1902908 (-) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| FQP84_RS09775 (FQP84_09775) | lukH | 1903343..1904398 (+) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| FQP84_RS09780 (FQP84_09780) | lukG | 1904420..1905436 (+) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| FQP84_RS09785 (FQP84_09785) | sph | 1905674..1906498 (-) | 825 | Protein_1873 | sphingomyelin phosphodiesterase | - |
| FQP84_RS09790 (FQP84_09790) | - | 1906555..1907592 (-) | 1038 | WP_000857176.1 | site-specific integrase | - |
| FQP84_RS09795 (FQP84_09795) | - | 1907700..1908314 (+) | 615 | WP_000191459.1 | hypothetical protein | - |
| FQP84_RS09800 (FQP84_09800) | - | 1908311..1908457 (-) | 147 | WP_001013104.1 | hypothetical protein | - |
| FQP84_RS09805 (FQP84_09805) | - | 1908493..1908675 (-) | 183 | WP_000705240.1 | hypothetical protein | - |
| FQP84_RS09810 (FQP84_09810) | - | 1908875..1909645 (-) | 771 | WP_031783378.1 | S24 family peptidase | - |
| FQP84_RS09815 (FQP84_09815) | - | 1909804..1910028 (+) | 225 | WP_000338186.1 | DUF739 family protein | - |
| FQP84_RS09820 (FQP84_09820) | - | 1910046..1910306 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| FQP84_RS09825 (FQP84_09825) | - | 1910330..1910869 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| FQP84_RS09830 (FQP84_09830) | - | 1910926..1911675 (+) | 750 | WP_001148337.1 | phage antirepressor KilAC domain-containing protein | - |
| FQP84_RS09835 (FQP84_09835) | - | 1911691..1911888 (+) | 198 | WP_001148861.1 | hypothetical protein | - |
| FQP84_RS09840 (FQP84_09840) | - | 1911919..1912059 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| FQP84_RS09845 (FQP84_09845) | - | 1912074..1912706 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| FQP84_RS09850 (FQP84_09850) | - | 1912765..1913085 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| FQP84_RS09855 (FQP84_09855) | - | 1913082..1913243 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| FQP84_RS09860 (FQP84_09860) | - | 1913336..1913596 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| FQP84_RS09865 (FQP84_09865) | - | 1913605..1913868 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| FQP84_RS09870 (FQP84_09870) | - | 1913877..1915820 (+) | 1944 | WP_000700565.1 | AAA family ATPase | - |
| FQP84_RS09875 (FQP84_09875) | - | 1915822..1916742 (+) | 921 | WP_000138481.1 | recombinase RecT | - |
| FQP84_RS09880 (FQP84_09880) | - | 1916823..1917440 (+) | 618 | WP_235686151.1 | MBL fold metallo-hydrolase | - |
| FQP84_RS09885 (FQP84_09885) | ssbA | 1917441..1917911 (+) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| FQP84_RS09890 (FQP84_09890) | - | 1917941..1918825 (+) | 885 | WP_000148301.1 | DnaD domain protein | - |
| FQP84_RS09895 (FQP84_09895) | - | 1918832..1919050 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| FQP84_RS09900 (FQP84_09900) | - | 1919059..1919463 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FQP84_RS09905 (FQP84_09905) | - | 1919476..1919844 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| FQP84_RS09910 (FQP84_09910) | - | 1919848..1920090 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| FQP84_RS09915 (FQP84_09915) | - | 1920155..1920604 (+) | 450 | WP_000982711.1 | YopX family protein | - |
| FQP84_RS09920 (FQP84_09920) | - | 1920601..1921110 (+) | 510 | WP_001105598.1 | hypothetical protein | - |
| FQP84_RS09925 (FQP84_09925) | - | 1921107..1921517 (+) | 411 | WP_000197968.1 | hypothetical protein | - |
| FQP84_RS15770 | - | 1921510..1921635 (+) | 126 | Protein_1902 | DUF1024 family protein | - |
| FQP84_RS09935 (FQP84_09935) | - | 1921991..1922527 (+) | 537 | WP_001066444.1 | dUTPase | - |
| FQP84_RS09940 (FQP84_09940) | - | 1922564..1922770 (+) | 207 | WP_000195820.1 | DUF1381 domain-containing protein | - |
| FQP84_RS09945 (FQP84_09945) | rinB | 1922767..1922916 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| FQP84_RS09950 (FQP84_09950) | - | 1922916..1923116 (+) | 201 | WP_000265039.1 | DUF1514 family protein | - |
| FQP84_RS09955 (FQP84_09955) | - | 1923144..1923560 (+) | 417 | WP_000590126.1 | hypothetical protein | - |
| FQP84_RS09960 (FQP84_09960) | - | 1923792..1924091 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| FQP84_RS09965 (FQP84_09965) | - | 1924221..1924565 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| FQP84_RS09970 (FQP84_09970) | - | 1924562..1926223 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| FQP84_RS09975 (FQP84_09975) | - | 1926239..1927426 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| FQP84_RS09980 (FQP84_09980) | - | 1927410..1928147 (+) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| FQP84_RS09985 (FQP84_09985) | - | 1928171..1929316 (+) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| FQP84_RS09990 (FQP84_09990) | - | 1929336..1929620 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| FQP84_RS09995 (FQP84_09995) | - | 1929610..1929894 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| FQP84_RS10000 (FQP84_10000) | - | 1929878..1930240 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| FQP84_RS10005 (FQP84_10005) | - | 1930237..1930641 (+) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| FQP84_RS10010 (FQP84_10010) | - | 1930638..1931045 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| FQP84_RS10015 (FQP84_10015) | - | 1931046..1931690 (+) | 645 | WP_000268741.1 | major tail protein | - |
| FQP84_RS10020 (FQP84_10020) | - | 1931744..1931956 (+) | 213 | WP_230402383.1 | Ig-like domain-containing protein | - |
| FQP84_RS10025 (FQP84_10025) | gpG | 1932006..1932356 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| FQP84_RS15645 | gpGT | 1932407..1932544 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| FQP84_RS10030 (FQP84_10030) | - | 1932601..1937130 (+) | 4530 | WP_031836434.1 | phage tail tape measure protein | - |
| FQP84_RS10035 (FQP84_10035) | - | 1937127..1938611 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| FQP84_RS10040 (FQP84_10040) | - | 1938627..1942409 (+) | 3783 | WP_031836433.1 | phage tail spike protein | - |
| FQP84_RS10045 (FQP84_10045) | - | 1942402..1942554 (+) | 153 | WP_001000058.1 | hypothetical protein | - |
| FQP84_RS10050 (FQP84_10050) | - | 1942600..1942887 (+) | 288 | WP_001262621.1 | hypothetical protein | - |
| FQP84_RS10055 (FQP84_10055) | - | 1942943..1943317 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| FQP84_RS10060 (FQP84_10060) | sea | 1943690..1944463 (+) | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| FQP84_RS10065 (FQP84_10065) | pepG1 | 1944614..1944748 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| FQP84_RS10070 (FQP84_10070) | - | 1944801..1944908 (-) | 108 | WP_031762631.1 | hypothetical protein | - |
| FQP84_RS10075 (FQP84_10075) | - | 1944960..1945214 (+) | 255 | WP_000611512.1 | phage holin | - |
| FQP84_RS10080 (FQP84_10080) | - | 1945226..1945981 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| FQP84_RS10085 (FQP84_10085) | sak | 1946172..1946663 (+) | 492 | WP_000920038.1 | staphylokinase | - |
| FQP84_RS10105 (FQP84_10105) | - | 1947311..1947649 (+) | 339 | Protein_1935 | SH3 domain-containing protein | - |
| FQP84_RS10110 (FQP84_10110) | scn | 1948160..1948510 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=382723 FQP84_RS09885 WP_000934770.1 1917441..1917911(+) (ssbA) [Staphylococcus aureus strain 16445]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=382723 FQP84_RS09885 WP_000934770.1 1917441..1917911(+) (ssbA) [Staphylococcus aureus strain 16445]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |