Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   FR761_RS16530 Genome accession   NZ_CP042556
Coordinates   3409149..3409502 (+) Length   117 a.a.
NCBI ID   WP_151532449.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain E47     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3375094..3416591 3409149..3409502 within 0


Gene organization within MGE regions


Location: 3375094..3416591
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FR761_RS16310 (FR761_16310) - 3375094..3375894 (-) 801 WP_000992380.1 Rha family transcriptional regulator -
  FR761_RS21305 - 3375891..3376022 (-) 132 WP_265586710.1 hypothetical protein -
  FR761_RS16315 (FR761_16315) - 3376386..3377264 (+) 879 WP_024436829.1 DUF4747 family protein -
  FR761_RS16320 (FR761_16320) - 3377272..3377961 (+) 690 WP_024436830.1 hypothetical protein -
  FR761_RS16325 (FR761_16325) - 3378037..3378432 (+) 396 WP_151532438.1 hypothetical protein -
  FR761_RS16330 (FR761_16330) - 3378508..3379212 (+) 705 WP_114203521.1 hypothetical protein -
  FR761_RS16335 (FR761_16335) - 3379223..3379684 (-) 462 WP_114203519.1 type II toxin-antitoxin system YafO family toxin -
  FR761_RS20905 - 3379687..3379851 (-) 165 WP_171293097.1 hypothetical protein -
  FR761_RS16340 (FR761_16340) - 3380122..3381108 (-) 987 WP_123785441.1 phage portal protein -
  FR761_RS16345 (FR761_16345) - 3381109..3382893 (-) 1785 WP_002056049.1 terminase large subunit domain-containing protein -
  FR761_RS16350 (FR761_16350) - 3383051..3383854 (+) 804 WP_024436834.1 GPO family capsid scaffolding protein -
  FR761_RS16355 (FR761_16355) - 3383870..3384859 (+) 990 WP_032035661.1 phage major capsid protein, P2 family -
  FR761_RS16360 (FR761_16360) gpM 3384870..3385631 (+) 762 WP_114203513.1 phage terminase small subunit -
  FR761_RS16365 (FR761_16365) - 3385734..3386186 (+) 453 WP_038347293.1 head completion/stabilization protein -
  FR761_RS16370 (FR761_16370) - 3386187..3386396 (+) 210 WP_114203510.1 tail protein X -
  FR761_RS16375 (FR761_16375) - 3386405..3386755 (+) 351 WP_001114936.1 putative holin -
  FR761_RS16380 (FR761_16380) - 3386752..3387021 (+) 270 WP_114203509.1 phage holin family protein -
  FR761_RS16385 (FR761_16385) - 3387018..3387848 (+) 831 WP_114203507.1 N-acetylmuramidase domain-containing protein -
  FR761_RS16390 (FR761_16390) - 3387845..3388372 (+) 528 WP_151532439.1 phage tail protein -
  FR761_RS16395 (FR761_16395) - 3388369..3388818 (+) 450 WP_151532440.1 phage virion morphogenesis protein -
  FR761_RS16400 (FR761_16400) - 3388891..3389517 (+) 627 WP_151532441.1 phage baseplate assembly protein V -
  FR761_RS16405 (FR761_16405) - 3389514..3389861 (+) 348 WP_032014595.1 GPW/gp25 family protein -
  FR761_RS16410 (FR761_16410) - 3389858..3390760 (+) 903 WP_151532442.1 baseplate J/gp47 family protein -
  FR761_RS16415 (FR761_16415) - 3390760..3391365 (+) 606 WP_151532443.1 phage tail protein I -
  FR761_RS21220 - 3391377..3393788 (+) 2412 WP_228719264.1 phage tail protein -
  FR761_RS16425 (FR761_16425) - 3393947..3395122 (+) 1176 WP_151532444.1 phage tail sheath protein -
  FR761_RS16430 (FR761_16430) - 3395135..3395653 (+) 519 WP_031987639.1 phage major tail tube protein -
  FR761_RS16435 (FR761_16435) - 3395721..3396062 (+) 342 WP_001071617.1 phage tail assembly protein -
  FR761_RS16440 (FR761_16440) - 3396107..3396202 (+) 96 WP_238967504.1 GpE family phage tail protein -
  FR761_RS16445 (FR761_16445) - 3396216..3398666 (+) 2451 WP_151532445.1 phage tail tape measure protein -
  FR761_RS16450 (FR761_16450) - 3398673..3399113 (+) 441 WP_057069934.1 phage tail protein -
  FR761_RS16455 (FR761_16455) - 3399114..3400427 (+) 1314 WP_151532446.1 contractile injection system protein, VgrG/Pvc8 family -
  FR761_RS16460 (FR761_16460) - 3400557..3400796 (+) 240 WP_000113725.1 ogr/Delta-like zinc finger family protein -
  FR761_RS16465 (FR761_16465) - 3400793..3400993 (+) 201 WP_002056021.1 TraR/DksA C4-type zinc finger protein -
  FR761_RS16475 (FR761_16475) - 3401309..3401590 (-) 282 WP_002056046.1 hypothetical protein -
  FR761_RS16480 (FR761_16480) - 3401590..3402468 (-) 879 WP_151532447.1 BRCT domain-containing protein -
  FR761_RS16485 (FR761_16485) - 3402780..3402974 (+) 195 WP_002056034.1 hypothetical protein -
  FR761_RS16490 (FR761_16490) - 3403082..3403906 (+) 825 WP_002056074.1 Rha family transcriptional regulator -
  FR761_RS16495 (FR761_16495) - 3404031..3404246 (+) 216 WP_000556352.1 hypothetical protein -
  FR761_RS16500 (FR761_16500) - 3404291..3404632 (-) 342 WP_000786718.1 helix-turn-helix domain-containing protein -
  FR761_RS16505 (FR761_16505) - 3404725..3404913 (+) 189 WP_001043170.1 hypothetical protein -
  FR761_RS16510 (FR761_16510) - 3405007..3407745 (+) 2739 WP_002056063.1 toprim domain-containing protein -
  FR761_RS16515 (FR761_16515) - 3407742..3408074 (+) 333 WP_151532448.1 hypothetical protein -
  FR761_RS16520 (FR761_16520) - 3408140..3408691 (+) 552 WP_002056024.1 hypothetical protein -
  FR761_RS20910 - 3408681..3408851 (+) 171 WP_001015076.1 hypothetical protein -
  FR761_RS16525 (FR761_16525) - 3408844..3409161 (+) 318 WP_000049658.1 hypothetical protein -
  FR761_RS16530 (FR761_16530) ssb 3409149..3409502 (+) 354 WP_151532449.1 single-stranded DNA-binding protein Machinery gene
  FR761_RS16535 (FR761_16535) - 3409512..3410249 (+) 738 WP_151532450.1 3'-5' exonuclease -
  FR761_RS16540 (FR761_16540) - 3410258..3410479 (+) 222 WP_171492683.1 hypothetical protein -
  FR761_RS16545 (FR761_16545) - 3410476..3410772 (+) 297 WP_000218943.1 hypothetical protein -
  FR761_RS16550 (FR761_16550) - 3410800..3411867 (-) 1068 WP_151532452.1 tyrosine-type recombinase/integrase -
  FR761_RS16560 (FR761_16560) queA 3412314..3413351 (+) 1038 WP_001177138.1 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA -
  FR761_RS16565 (FR761_16565) - 3413437..3414342 (+) 906 WP_151532453.1 hypothetical protein -
  FR761_RS16570 (FR761_16570) - 3414311..3415530 (+) 1220 WP_087486619.1 IS3-like element ISAba19 family transposase -
  FR761_RS16575 (FR761_16575) - 3415659..3416591 (+) 933 WP_025469473.1 IS5 family transposase -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13351.11 Da        Isoelectric Point: 9.7939

>NTDB_id=378426 FR761_RS16530 WP_151532449.1 3409149..3409502(+) (ssb) [Acinetobacter baumannii strain E47]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV

Nucleotide


Download         Length: 354 bp        

>NTDB_id=378426 FR761_RS16530 WP_151532449.1 3409149..3409502(+) (ssb) [Acinetobacter baumannii strain E47]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGTGACTGGATTGAAAACACAGAGTGGC
ATCGTATTGTTGCCCACAACCGACTAGGTGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

56.364

94.017

0.53
  ssb Vibrio cholerae strain A1552

55.556

84.615

0.47
  ssb Neisseria meningitidis MC58

41.905

89.744

0.376
  ssb Neisseria gonorrhoeae MS11

41.905

89.744

0.376

Multiple sequence alignment