Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | FPZ51_RS05925 | Genome accession | NZ_CP042242 |
| Coordinates | 1304228..1304677 (-) | Length | 149 a.a. |
| NCBI ID | WP_086131796.1 | Uniprot ID | - |
| Organism | Oxalobacter formigenes strain SSYG-15 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1302356..1340435 | 1304228..1304677 | within | 0 |
Gene organization within MGE regions
Location: 1302356..1340435
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FPZ51_RS05910 (FPZ51_05910) | - | 1302356..1303021 (-) | 666 | WP_231284476.1 | LexA family transcriptional regulator | - |
| FPZ51_RS05915 (FPZ51_05915) | - | 1303529..1303816 (-) | 288 | WP_086131798.1 | AlpA family transcriptional regulator | - |
| FPZ51_RS11590 | - | 1303895..1304026 (-) | 132 | WP_257789307.1 | hypothetical protein | - |
| FPZ51_RS05920 (FPZ51_05920) | - | 1304023..1304202 (-) | 180 | WP_086131797.1 | hypothetical protein | - |
| FPZ51_RS05925 (FPZ51_05925) | ssb | 1304228..1304677 (-) | 450 | WP_086131796.1 | single-stranded DNA-binding protein | Machinery gene |
| FPZ51_RS05930 (FPZ51_05930) | - | 1304680..1305135 (-) | 456 | WP_086131795.1 | class I SAM-dependent methyltransferase | - |
| FPZ51_RS05935 (FPZ51_05935) | - | 1305132..1305764 (-) | 633 | WP_086131794.1 | hypothetical protein | - |
| FPZ51_RS05940 (FPZ51_05940) | - | 1305761..1306135 (-) | 375 | WP_086131793.1 | hypothetical protein | - |
| FPZ51_RS05945 (FPZ51_05945) | - | 1306122..1306346 (-) | 225 | WP_086131792.1 | hypothetical protein | - |
| FPZ51_RS05950 (FPZ51_05950) | - | 1306343..1307380 (-) | 1038 | WP_086131791.1 | DUF5131 family protein | - |
| FPZ51_RS05960 (FPZ51_05960) | - | 1307568..1307927 (-) | 360 | WP_086131789.1 | DUF4406 domain-containing protein | - |
| FPZ51_RS11470 | - | 1307917..1308693 (-) | 777 | WP_198341922.1 | DUF3310 domain-containing protein | - |
| FPZ51_RS05970 (FPZ51_05970) | - | 1308703..1308882 (-) | 180 | WP_086131788.1 | hypothetical protein | - |
| FPZ51_RS11390 | - | 1308886..1309026 (-) | 141 | WP_157661015.1 | hypothetical protein | - |
| FPZ51_RS05975 (FPZ51_05975) | - | 1309035..1309565 (-) | 531 | WP_145814966.1 | hypothetical protein | - |
| FPZ51_RS05980 (FPZ51_05980) | - | 1309774..1310163 (-) | 390 | WP_198341921.1 | helix-turn-helix domain-containing protein | - |
| FPZ51_RS05985 (FPZ51_05985) | - | 1310218..1310442 (+) | 225 | WP_186447524.1 | hypothetical protein | - |
| FPZ51_RS05990 (FPZ51_05990) | - | 1310474..1310926 (+) | 453 | WP_315897818.1 | YmfL family putative regulatory protein | - |
| FPZ51_RS11395 | - | 1311093..1311233 (+) | 141 | WP_157661014.1 | hypothetical protein | - |
| FPZ51_RS05995 (FPZ51_05995) | - | 1311230..1311625 (+) | 396 | WP_086131782.1 | winged helix-turn-helix domain-containing protein | - |
| FPZ51_RS06000 (FPZ51_06000) | - | 1311652..1311936 (-) | 285 | WP_086131781.1 | addiction module antidote protein | - |
| FPZ51_RS06005 (FPZ51_06005) | - | 1311940..1312233 (-) | 294 | WP_086131780.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| FPZ51_RS06010 (FPZ51_06010) | - | 1312325..1313047 (+) | 723 | WP_086131779.1 | BRO family protein | - |
| FPZ51_RS06015 (FPZ51_06015) | - | 1313040..1313885 (+) | 846 | WP_086131778.1 | KilA-N domain-containing protein | - |
| FPZ51_RS06020 (FPZ51_06020) | - | 1313878..1316391 (+) | 2514 | WP_086131777.1 | DUF5906 domain-containing protein | - |
| FPZ51_RS06025 (FPZ51_06025) | - | 1316714..1317073 (+) | 360 | WP_086131775.1 | antiterminator Q family protein | - |
| FPZ51_RS06030 (FPZ51_06030) | - | 1317381..1318160 (+) | 780 | WP_145814967.1 | hypothetical protein | - |
| FPZ51_RS06035 (FPZ51_06035) | - | 1318214..1318981 (+) | 768 | WP_145814968.1 | hypothetical protein | - |
| FPZ51_RS06040 (FPZ51_06040) | - | 1319171..1319773 (+) | 603 | WP_086131772.1 | hypothetical protein | - |
| FPZ51_RS06045 (FPZ51_06045) | - | 1319766..1321901 (+) | 2136 | WP_086131771.1 | phage terminase large subunit family protein | - |
| FPZ51_RS06050 (FPZ51_06050) | - | 1321910..1322128 (+) | 219 | WP_086131770.1 | phage head-tail joining protein | - |
| FPZ51_RS06055 (FPZ51_06055) | - | 1322132..1323583 (+) | 1452 | WP_086131769.1 | phage portal protein | - |
| FPZ51_RS06060 (FPZ51_06060) | - | 1323645..1325681 (+) | 2037 | WP_086131768.1 | prohead protease/major capsid protein fusion protein | - |
| FPZ51_RS06065 (FPZ51_06065) | - | 1325764..1326114 (+) | 351 | WP_086131826.1 | DUF2190 family protein | - |
| FPZ51_RS06070 (FPZ51_06070) | - | 1326114..1326419 (+) | 306 | WP_086131767.1 | hypothetical protein | - |
| FPZ51_RS06075 (FPZ51_06075) | - | 1326416..1326823 (+) | 408 | WP_086131766.1 | hypothetical protein | - |
| FPZ51_RS06080 (FPZ51_06080) | - | 1326837..1327769 (+) | 933 | WP_086131765.1 | phage tail tube protein | - |
| FPZ51_RS06085 (FPZ51_06085) | - | 1327779..1328105 (+) | 327 | WP_086131764.1 | hypothetical protein | - |
| FPZ51_RS06090 (FPZ51_06090) | - | 1328228..1328494 (+) | 267 | WP_257789324.1 | DUF1799 domain-containing protein | - |
| FPZ51_RS06095 (FPZ51_06095) | - | 1328484..1331027 (+) | 2544 | WP_086131762.1 | phage tail length tape measure family protein | - |
| FPZ51_RS06100 (FPZ51_06100) | - | 1331027..1331422 (+) | 396 | WP_086131761.1 | hypothetical protein | - |
| FPZ51_RS06105 (FPZ51_06105) | - | 1331415..1331939 (+) | 525 | WP_086131760.1 | DUF1833 family protein | - |
| FPZ51_RS06110 (FPZ51_06110) | - | 1331936..1332322 (+) | 387 | WP_086131759.1 | NlpC/P60 family protein | - |
| FPZ51_RS06115 (FPZ51_06115) | - | 1332296..1332784 (-) | 489 | WP_036602557.1 | membrane lipoprotein lipid attachment site-containing protein | - |
| FPZ51_RS06120 (FPZ51_06120) | - | 1332865..1335465 (+) | 2601 | WP_086131758.1 | host specificity factor TipJ family phage tail protein | - |
| FPZ51_RS06125 (FPZ51_06125) | - | 1335478..1336014 (+) | 537 | WP_198341920.1 | hypothetical protein | - |
| FPZ51_RS06130 (FPZ51_06130) | - | 1336017..1336643 (+) | 627 | WP_086131757.1 | hypothetical protein | - |
| FPZ51_RS06140 (FPZ51_06140) | - | 1336879..1337097 (+) | 219 | WP_086131755.1 | hypothetical protein | - |
| FPZ51_RS06145 (FPZ51_06145) | - | 1337090..1337596 (+) | 507 | WP_086131754.1 | lysozyme | - |
| FPZ51_RS06150 (FPZ51_06150) | - | 1337627..1338061 (+) | 435 | WP_086131753.1 | hypothetical protein | - |
| FPZ51_RS06155 (FPZ51_06155) | - | 1338179..1339156 (-) | 978 | WP_086131752.1 | site-specific integrase | - |
| FPZ51_RS06165 (FPZ51_06165) | - | 1339539..1340435 (+) | 897 | WP_005880559.1 | alpha/beta hydrolase | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16950.86 Da Isoelectric Point: 7.0184
>NTDB_id=376125 FPZ51_RS05925 WP_086131796.1 1304228..1304677(-) (ssb) [Oxalobacter formigenes strain SSYG-15]
MASINKVIIVGNLGRDPENRYLPSGEQVTSITVATTDRWRDKTSGEQKEQTEWHRISFFGKLAEIAGQYLKKGSQVYIEG
RLRTRKYTDKEGVDRYATEIIADTMQMLGSRQDSQSTGRNEYAEQTGRSQPTQRKTPPTADMLDDDIPF
MASINKVIIVGNLGRDPENRYLPSGEQVTSITVATTDRWRDKTSGEQKEQTEWHRISFFGKLAEIAGQYLKKGSQVYIEG
RLRTRKYTDKEGVDRYATEIIADTMQMLGSRQDSQSTGRNEYAEQTGRSQPTQRKTPPTADMLDDDIPF
Nucleotide
Download Length: 450 bp
>NTDB_id=376125 FPZ51_RS05925 WP_086131796.1 1304228..1304677(-) (ssb) [Oxalobacter formigenes strain SSYG-15]
ATGGCATCAATCAACAAAGTAATCATCGTCGGCAATCTTGGCCGGGATCCTGAAAATCGCTATTTGCCAAGTGGCGAACA
GGTCACCAGTATCACTGTCGCAACGACTGATCGCTGGCGTGACAAAACATCGGGTGAACAGAAAGAACAGACCGAATGGC
ACCGTATTTCATTCTTCGGCAAACTGGCAGAGATTGCCGGTCAGTATCTGAAAAAGGGTTCACAGGTCTATATCGAAGGC
CGTCTGAGAACGCGTAAATATACCGACAAGGAAGGTGTTGACCGTTACGCGACCGAAATCATCGCCGACACCATGCAAAT
GCTCGGCAGCCGTCAGGATTCACAAAGCACGGGGCGGAATGAGTACGCCGAACAGACAGGACGGTCACAGCCTACGCAGC
GCAAGACCCCGCCAACTGCCGACATGTTGGACGATGATATTCCCTTCTGA
ATGGCATCAATCAACAAAGTAATCATCGTCGGCAATCTTGGCCGGGATCCTGAAAATCGCTATTTGCCAAGTGGCGAACA
GGTCACCAGTATCACTGTCGCAACGACTGATCGCTGGCGTGACAAAACATCGGGTGAACAGAAAGAACAGACCGAATGGC
ACCGTATTTCATTCTTCGGCAAACTGGCAGAGATTGCCGGTCAGTATCTGAAAAAGGGTTCACAGGTCTATATCGAAGGC
CGTCTGAGAACGCGTAAATATACCGACAAGGAAGGTGTTGACCGTTACGCGACCGAAATCATCGCCGACACCATGCAAAT
GCTCGGCAGCCGTCAGGATTCACAAAGCACGGGGCGGAATGAGTACGCCGAACAGACAGGACGGTCACAGCCTACGCAGC
GCAAGACCCCGCCAACTGCCGACATGTTGGACGATGATATTCCCTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
50 |
100 |
0.597 |
| ssb | Glaesserella parasuis strain SC1401 |
46.667 |
100 |
0.564 |
| ssb | Neisseria meningitidis MC58 |
44.318 |
100 |
0.523 |
| ssb | Neisseria gonorrhoeae MS11 |
44.318 |
100 |
0.523 |