Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D5R83_RS07580 Genome accession   NZ_CP042211
Coordinates   1555750..1555863 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain B128 7.13     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1550750..1560863
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D5R83_RS07560 (D5R83_07560) - 1551416..1552828 (-) 1413 WP_001861341.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D5R83_RS07565 (D5R83_07565) comB10 1552898..1554034 (-) 1137 WP_001045869.1 DNA type IV secretion system protein ComB10 Machinery gene
  D5R83_RS07570 (D5R83_07570) comB9 1554027..1555010 (-) 984 WP_001861340.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D5R83_RS07575 (D5R83_07575) comB8 1555010..1555753 (-) 744 WP_000660520.1 virB8 family protein Machinery gene
  D5R83_RS07580 (D5R83_07580) comB7 1555750..1555863 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D5R83_RS07585 (D5R83_07585) comB6 1555879..1556934 (-) 1056 WP_000786677.1 P-type conjugative transfer protein TrbL Machinery gene
  D5R83_RS07590 (D5R83_07590) - 1556942..1557937 (-) 996 WP_000468428.1 PDZ domain-containing protein -
  D5R83_RS07595 (D5R83_07595) - 1557937..1558239 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  D5R83_RS07600 (D5R83_07600) panD 1558242..1558595 (-) 354 WP_000142236.1 aspartate 1-decarboxylase -
  D5R83_RS07605 (D5R83_07605) - 1558585..1560810 (-) 2226 WP_001051506.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=376008 D5R83_RS07580 WP_001217873.1 1555750..1555863(-) (comB7) [Helicobacter pylori strain B128 7.13]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=376008 D5R83_RS07580 WP_001217873.1 1555750..1555863(-) (comB7) [Helicobacter pylori strain B128 7.13]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment