Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   FPL17_RS17140 Genome accession   NZ_CP041970
Coordinates   3700959..3701312 (-) Length   117 a.a.
NCBI ID   WP_159886387.1    Uniprot ID   -
Organism   Acinetobacter dispersus strain NCCP 16014     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3699355..3738182 3700959..3701312 within 0


Gene organization within MGE regions


Location: 3699355..3738182
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FPL17_RS17125 (FPL17_17320) - 3699355..3700419 (+) 1065 WP_159886381.1 tyrosine-type recombinase/integrase -
  FPL17_RS17130 (FPL17_17325) - 3700446..3700745 (-) 300 WP_159886383.1 hypothetical protein -
  FPL17_RS17135 (FPL17_17330) - 3700749..3700946 (-) 198 WP_159886385.1 hypothetical protein -
  FPL17_RS17140 (FPL17_17335) ssb 3700959..3701312 (-) 354 WP_159886387.1 single-stranded DNA-binding protein Machinery gene
  FPL17_RS17145 (FPL17_17340) - 3701312..3701692 (-) 381 WP_159886389.1 hypothetical protein -
  FPL17_RS17150 (FPL17_17345) - 3701689..3701898 (-) 210 WP_159886391.1 hypothetical protein -
  FPL17_RS17155 (FPL17_17350) - 3701916..3702344 (-) 429 WP_159886393.1 DUF2528 family protein -
  FPL17_RS17160 (FPL17_17355) - 3702412..3705141 (-) 2730 WP_159886395.1 toprim domain-containing protein -
  FPL17_RS17165 (FPL17_17360) - 3705138..3705500 (-) 363 WP_159886397.1 hypothetical protein -
  FPL17_RS17170 (FPL17_17365) - 3705817..3706008 (-) 192 WP_159886399.1 hypothetical protein -
  FPL17_RS17175 (FPL17_17370) - 3706145..3706501 (+) 357 WP_159886401.1 helix-turn-helix domain-containing protein -
  FPL17_RS17180 (FPL17_17375) - 3707009..3707683 (-) 675 WP_159886403.1 hypothetical protein -
  FPL17_RS17185 (FPL17_17385) - 3708212..3708910 (+) 699 WP_159886405.1 hypothetical protein -
  FPL17_RS17190 (FPL17_17390) - 3709152..3710699 (+) 1548 WP_159886407.1 hypothetical protein -
  FPL17_RS17195 (FPL17_17395) - 3710799..3711338 (+) 540 WP_159886409.1 hypothetical protein -
  FPL17_RS17200 (FPL17_17400) - 3711357..3711794 (+) 438 WP_159886411.1 hypothetical protein -
  FPL17_RS17205 (FPL17_17405) - 3711825..3712103 (-) 279 WP_159886413.1 hypothetical protein -
  FPL17_RS17210 (FPL17_17410) - 3712361..3712540 (+) 180 WP_159886415.1 type II toxin-antitoxin system HicA family toxin -
  FPL17_RS17215 (FPL17_17415) - 3712789..3713208 (+) 420 WP_159886417.1 type II toxin-antitoxin system HicB family antitoxin -
  FPL17_RS17220 (FPL17_17420) - 3713359..3713937 (+) 579 WP_159886419.1 LexA family protein -
  FPL17_RS17225 (FPL17_17425) - 3713934..3715223 (+) 1290 WP_159886421.1 Y-family DNA polymerase -
  FPL17_RS17230 (FPL17_17430) - 3715220..3716182 (-) 963 WP_228277579.1 contractile injection system protein, VgrG/Pvc8 family -
  FPL17_RS17235 (FPL17_17435) - 3716200..3716619 (-) 420 WP_159886425.1 phage tail protein -
  FPL17_RS17240 (FPL17_17440) - 3716628..3719222 (-) 2595 WP_159886426.1 phage tail tape measure protein -
  FPL17_RS17245 (FPL17_17445) - 3719219..3719326 (-) 108 WP_266095740.1 GpE family phage tail protein -
  FPL17_RS17250 (FPL17_17450) - 3719356..3719706 (-) 351 WP_159886428.1 phage tail assembly protein -
  FPL17_RS17255 (FPL17_17455) - 3719783..3720295 (-) 513 WP_159886430.1 phage major tail tube protein -
  FPL17_RS17260 (FPL17_17460) - 3720308..3720961 (-) 654 WP_159886432.1 phage tail sheath C-terminal domain-containing protein -
  FPL17_RS17265 (FPL17_17465) - 3720976..3721791 (-) 816 WP_159886434.1 leucine-rich repeat domain-containing protein -
  FPL17_RS17270 (FPL17_17470) - 3721908..3722555 (-) 648 WP_228277580.1 hypothetical protein -
  FPL17_RS17275 (FPL17_17475) - 3722586..3723653 (-) 1068 WP_159886438.1 phage tail protein -
  FPL17_RS17280 (FPL17_17480) - 3723659..3724600 (-) 942 WP_159886440.1 hypothetical protein -
  FPL17_RS17285 (FPL17_17485) - 3724613..3725137 (-) 525 WP_159886442.1 phage tail protein I -
  FPL17_RS17290 (FPL17_17490) - 3725130..3726029 (-) 900 WP_159886444.1 baseplate assembly protein -
  FPL17_RS17295 (FPL17_17495) - 3726026..3726391 (-) 366 WP_159886446.1 GPW/gp25 family protein -
  FPL17_RS17300 (FPL17_17500) - 3726388..3726906 (-) 519 WP_159886447.1 phage baseplate assembly protein V -
  FPL17_RS17305 (FPL17_17505) - 3726987..3727835 (-) 849 WP_159886449.1 DNA adenine methylase -
  FPL17_RS19115 (FPL17_17510) - 3727786..3727992 (-) 207 WP_159886451.1 Com family DNA-binding transcriptional regulator -
  FPL17_RS17315 (FPL17_17515) - 3727992..3728429 (-) 438 WP_159886453.1 phage virion morphogenesis protein -
  FPL17_RS17320 (FPL17_17520) - 3728426..3728812 (-) 387 WP_159886455.1 phage tail protein -
  FPL17_RS17325 (FPL17_17525) - 3728824..3729369 (-) 546 WP_159886456.1 glycoside hydrolase family 108 protein -
  FPL17_RS17330 (FPL17_17530) - 3729366..3729698 (-) 333 WP_159886458.1 phage holin family protein -
  FPL17_RS17335 (FPL17_17535) - 3729713..3729919 (-) 207 WP_159886460.1 tail protein X -
  FPL17_RS17340 (FPL17_17540) - 3729916..3730326 (-) 411 WP_159886462.1 head completion/stabilization protein -
  FPL17_RS17345 (FPL17_17545) gpM 3730329..3731216 (-) 888 WP_159886464.1 phage terminase small subunit -
  FPL17_RS17350 (FPL17_17550) - 3731216..3732253 (-) 1038 WP_159886466.1 phage major capsid protein, P2 family -
  FPL17_RS17355 (FPL17_17555) - 3732309..3733241 (-) 933 WP_159886468.1 GPO family capsid scaffolding protein -
  FPL17_RS17360 (FPL17_17560) - 3733389..3735200 (+) 1812 WP_159886470.1 terminase large subunit domain-containing protein -
  FPL17_RS17365 (FPL17_17565) - 3735200..3736273 (+) 1074 WP_159886472.1 phage portal protein -
  FPL17_RS17370 (FPL17_17570) - 3736638..3736853 (-) 216 WP_159886473.1 hypothetical protein -
  FPL17_RS17375 (FPL17_17575) - 3737505..3738182 (-) 678 WP_228267279.1 LysM peptidoglycan-binding domain-containing protein -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13247.01 Da        Isoelectric Point: 10.0219

>NTDB_id=375107 FPL17_RS17140 WP_159886387.1 3700959..3701312(-) (ssb) [Acinetobacter dispersus strain NCCP 16014]
MRGINKVILVGSLGADPQKKNFPNGGSYTQFSIATSEKWQDKQSGAWNEKTEWHRVVANGKLGDIAAQYLKKGSKVYVEG
SLHTRLWKDQQNIERYMTEVKIQSMQMLDSAPQANPY

Nucleotide


Download         Length: 354 bp        

>NTDB_id=375107 FPL17_RS17140 WP_159886387.1 3700959..3701312(-) (ssb) [Acinetobacter dispersus strain NCCP 16014]
ATGCGAGGTATCAATAAAGTTATTTTGGTGGGTTCTCTTGGAGCAGATCCACAGAAAAAGAATTTTCCTAATGGTGGTTC
ATATACTCAATTTTCAATTGCTACTTCAGAAAAATGGCAGGATAAACAATCAGGTGCTTGGAATGAAAAAACAGAATGGC
ATCGTGTTGTGGCCAACGGAAAGCTAGGTGATATTGCAGCCCAATACCTAAAAAAAGGGTCAAAAGTTTATGTGGAAGGT
TCCCTTCATACTCGGTTATGGAAAGATCAACAGAACATTGAACGCTACATGACTGAAGTAAAAATTCAAAGCATGCAAAT
GCTCGACTCAGCTCCACAAGCAAACCCATATTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

54.955

94.872

0.521
  ssb Glaesserella parasuis strain SC1401

53.636

94.017

0.504
  ssb Neisseria gonorrhoeae MS11

45.714

89.744

0.41
  ssb Neisseria meningitidis MC58

45.714

89.744

0.41

Multiple sequence alignment