Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   D069_RS11970 Genome accession   NZ_CP041143
Coordinates   2455411..2455788 (-) Length   125 a.a.
NCBI ID   WP_038459177.1    Uniprot ID   -
Organism   Bacillus velezensis strain UCMB5007     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2450411..2460788
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D069_RS11930 (D069_2221) - 2450908..2451702 (+) 795 WP_007612541.1 YqhG family protein -
  D069_RS11935 (D069_2222) sinI 2451879..2452052 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  D069_RS11940 (D069_2223) sinR 2452086..2452421 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  D069_RS11945 (D069_2224) tasA 2452469..2453254 (-) 786 WP_044802563.1 biofilm matrix protein TasA -
  D069_RS11950 (D069_2225) sipW 2453319..2453903 (-) 585 WP_015240205.1 signal peptidase I SipW -
  D069_RS11955 (D069_2226) tapA 2453875..2454546 (-) 672 WP_044802562.1 amyloid fiber anchoring/assembly protein TapA -
  D069_RS11960 (D069_2227) - 2454805..2455134 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  D069_RS11965 (D069_2228) - 2455175..2455354 (-) 180 WP_022552966.1 YqzE family protein -
  D069_RS11970 (D069_2229) comGG 2455411..2455788 (-) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  D069_RS11975 (D069_2230) comGF 2455789..2456289 (-) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  D069_RS11980 (D069_2231) comGE 2456198..2456512 (-) 315 WP_105937524.1 competence type IV pilus minor pilin ComGE -
  D069_RS11985 (D069_2232) comGD 2456496..2456933 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  D069_RS11990 (D069_2233) comGC 2456923..2457231 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  D069_RS11995 (D069_2234) comGB 2457236..2458273 (-) 1038 WP_105937523.1 competence type IV pilus assembly protein ComGB Machinery gene
  D069_RS12000 (D069_2235) comGA 2458260..2459330 (-) 1071 WP_007612574.1 competence type IV pilus ATPase ComGA Machinery gene
  D069_RS12005 (D069_2236) - 2459528..2460478 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14181.16 Da        Isoelectric Point: 10.1253

>NTDB_id=369678 D069_RS11970 WP_038459177.1 2455411..2455788(-) (comGG) [Bacillus velezensis strain UCMB5007]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGKKARTGTQRFPYGTVS
FHITGSDRRETVQITIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=369678 D069_RS11970 WP_038459177.1 2455411..2455788(-) (comGG) [Bacillus velezensis strain UCMB5007]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGATTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACTGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment