Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   D069_RS11935 Genome accession   NZ_CP041143
Coordinates   2451879..2452052 (+) Length   57 a.a.
NCBI ID   WP_007612543.1    Uniprot ID   -
Organism   Bacillus velezensis strain UCMB5007     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2446879..2457052
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D069_RS11920 (D069_2219) gcvT 2447692..2448792 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  D069_RS11925 (D069_2220) - 2449216..2450886 (+) 1671 WP_045208236.1 DEAD/DEAH box helicase -
  D069_RS11930 (D069_2221) - 2450908..2451702 (+) 795 WP_007612541.1 YqhG family protein -
  D069_RS11935 (D069_2222) sinI 2451879..2452052 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  D069_RS11940 (D069_2223) sinR 2452086..2452421 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  D069_RS11945 (D069_2224) tasA 2452469..2453254 (-) 786 WP_044802563.1 biofilm matrix protein TasA -
  D069_RS11950 (D069_2225) sipW 2453319..2453903 (-) 585 WP_015240205.1 signal peptidase I SipW -
  D069_RS11955 (D069_2226) tapA 2453875..2454546 (-) 672 WP_044802562.1 amyloid fiber anchoring/assembly protein TapA -
  D069_RS11960 (D069_2227) - 2454805..2455134 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  D069_RS11965 (D069_2228) - 2455175..2455354 (-) 180 WP_022552966.1 YqzE family protein -
  D069_RS11970 (D069_2229) comGG 2455411..2455788 (-) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  D069_RS11975 (D069_2230) comGF 2455789..2456289 (-) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  D069_RS11980 (D069_2231) comGE 2456198..2456512 (-) 315 WP_105937524.1 competence type IV pilus minor pilin ComGE -
  D069_RS11985 (D069_2232) comGD 2456496..2456933 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6672.68 Da        Isoelectric Point: 9.8168

>NTDB_id=369676 D069_RS11935 WP_007612543.1 2451879..2452052(+) (sinI) [Bacillus velezensis strain UCMB5007]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=369676 D069_RS11935 WP_007612543.1 2451879..2452052(+) (sinI) [Bacillus velezensis strain UCMB5007]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment