Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   FG175_RS05475 Genome accession   NZ_CP041134
Coordinates   1147486..1147941 (-) Length   151 a.a.
NCBI ID   WP_141958182.1    Uniprot ID   -
Organism   Serratia marcescens strain WVU-010     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1145935..1181278 1147486..1147941 within 0


Gene organization within MGE regions


Location: 1145935..1181278
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FG175_RS05455 (FG175_05455) - 1145935..1146471 (-) 537 WP_260439595.1 SAM-dependent methyltransferase -
  FG175_RS05460 (FG175_05460) - 1146468..1146941 (-) 474 WP_141984617.1 hypothetical protein -
  FG175_RS05465 (FG175_05465) - 1146938..1147117 (-) 180 WP_141984618.1 hypothetical protein -
  FG175_RS05470 (FG175_05470) - 1147126..1147458 (-) 333 WP_141958180.1 hypothetical protein -
  FG175_RS05475 (FG175_05475) ssb 1147486..1147941 (-) 456 WP_141958182.1 single-stranded DNA-binding protein Machinery gene
  FG175_RS05480 (FG175_05480) - 1147942..1148568 (-) 627 WP_141984619.1 ERF family protein -
  FG175_RS25615 - 1148577..1148747 (-) 171 WP_185741765.1 hypothetical protein -
  FG175_RS05485 (FG175_05485) - 1148857..1148988 (-) 132 WP_141958187.1 protease FtsH-inhibitory lysogeny factor CIII -
  FG175_RS05490 (FG175_05490) - 1149145..1149384 (-) 240 WP_141958189.1 hypothetical protein -
  FG175_RS05495 (FG175_05495) - 1149504..1149701 (-) 198 WP_141958191.1 hypothetical protein -
  FG175_RS05500 (FG175_05500) - 1149719..1149967 (-) 249 WP_071883557.1 hypothetical protein -
  FG175_RS05505 (FG175_05505) - 1150534..1150779 (-) 246 WP_141984620.1 hypothetical protein -
  FG175_RS05510 (FG175_05510) - 1151073..1151819 (-) 747 WP_260439597.1 XRE family transcriptional regulator -
  FG175_RS05515 (FG175_05515) - 1151854..1152081 (+) 228 WP_038876081.1 helix-turn-helix domain-containing protein -
  FG175_RS05520 (FG175_05520) - 1152210..1152488 (+) 279 WP_141984621.1 CII family transcriptional regulator -
  FG175_RS25620 - 1152524..1152688 (+) 165 WP_165877134.1 hypothetical protein -
  FG175_RS05525 (FG175_05525) - 1152675..1153571 (+) 897 WP_141984622.1 DNA replication protein -
  FG175_RS05530 (FG175_05530) - 1153558..1154964 (+) 1407 WP_141984623.1 DnaB-like helicase C-terminal domain-containing protein -
  FG175_RS05535 (FG175_05535) - 1155035..1155514 (-) 480 WP_260439599.1 DUF4145 domain-containing protein -
  FG175_RS05545 (FG175_05545) - 1155871..1156308 (+) 438 WP_141984626.1 recombination protein NinB -
  FG175_RS05550 (FG175_05550) - 1156335..1156475 (+) 141 WP_230200350.1 NinE family protein -
  FG175_RS05555 (FG175_05555) - 1156844..1156972 (+) 129 WP_141984628.1 protein NinF -
  FG175_RS05560 (FG175_05560) - 1156962..1157588 (+) 627 WP_141984629.1 recombination protein NinG -
  FG175_RS05565 (FG175_05565) - 1157973..1158407 (+) 435 WP_376697710.1 antiterminator Q family protein -
  FG175_RS05575 (FG175_05575) - 1158902..1159234 (+) 333 WP_042784830.1 phage holin, lambda family -
  FG175_RS05580 (FG175_05580) - 1159218..1159652 (+) 435 WP_141984631.1 lysozyme -
  FG175_RS05585 (FG175_05585) - 1159649..1160095 (+) 447 WP_141984632.1 lysis protein -
  FG175_RS05590 (FG175_05590) - 1160265..1160516 (+) 252 WP_141984633.1 hypothetical protein -
  FG175_RS05595 (FG175_05595) - 1160889..1161119 (+) 231 WP_141984634.1 DUF2560 family protein -
  FG175_RS25625 - 1161130..1161279 (+) 150 WP_185741870.1 hypothetical protein -
  FG175_RS05600 (FG175_05600) - 1161279..1161611 (+) 333 WP_141958224.1 DUF1737 domain-containing protein -
  FG175_RS05605 (FG175_05605) - 1161614..1162054 (+) 441 WP_141958226.1 terminase -
  FG175_RS05610 (FG175_05610) - 1162051..1163463 (+) 1413 WP_141958228.1 PBSX family phage terminase large subunit -
  FG175_RS05615 (FG175_05615) - 1163466..1165592 (+) 2127 WP_141958230.1 portal protein -
  FG175_RS05620 (FG175_05620) - 1165606..1166490 (+) 885 WP_141958232.1 phage capsid protein -
  FG175_RS05625 (FG175_05625) - 1166502..1167776 (+) 1275 WP_141958234.1 P22 phage major capsid protein family protein -
  FG175_RS05630 (FG175_05630) - 1167816..1168001 (+) 186 WP_141958236.1 hypothetical protein -
  FG175_RS05635 (FG175_05635) - 1167976..1168458 (+) 483 WP_004940081.1 packaged DNA stabilization gp4 family protein -
  FG175_RS05640 (FG175_05640) - 1168466..1169893 (+) 1428 WP_141984635.1 packaged DNA stabilization protein -
  FG175_RS05645 (FG175_05645) - 1169896..1170390 (+) 495 WP_141958240.1 HNH endonuclease -
  FG175_RS05650 (FG175_05650) - 1170390..1171298 (+) 909 WP_260439737.1 phage tail protein -
  FG175_RS05655 (FG175_05655) - 1171298..1171756 (+) 459 WP_141958244.1 DUF2824 family protein -
  FG175_RS05660 (FG175_05660) - 1171767..1172465 (+) 699 WP_141958246.1 DNA transfer protein -
  FG175_RS05665 (FG175_05665) - 1172465..1173814 (+) 1350 WP_141984636.1 phage DNA ejection protein -
  FG175_RS05670 (FG175_05670) - 1173814..1176291 (+) 2478 WP_141984637.1 lytic transglycosylase domain-containing protein -
  FG175_RS05675 (FG175_05675) - 1176309..1176782 (-) 474 WP_260439605.1 hypothetical protein -
  FG175_RS05680 (FG175_05680) - 1176800..1177051 (-) 252 WP_141984638.1 Arc family DNA-binding protein -
  FG175_RS25770 - 1177460..1179685 (+) 2226 WP_260439606.1 phage tailspike protein -
  FG175_RS05690 (FG175_05690) - 1180073..1181278 (+) 1206 WP_141958260.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 151 a.a.        Molecular weight: 16787.77 Da        Isoelectric Point: 6.4853

>NTDB_id=369622 FG175_RS05475 WP_141958182.1 1147486..1147941(-) (ssb) [Serratia marcescens strain WVU-010]
MASKGINKAIIIGNLGKDPEVRYTQNGGAIANLTIATSESWRDKQSGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGRLTTRKWEDQAGVERYTTEIHVNVGGVMQMIGSKQEASQSGNQPSPPKQQNKPQPSNEPPMDFDDDIPF

Nucleotide


Download         Length: 456 bp        

>NTDB_id=369622 FG175_RS05475 WP_141958182.1 1147486..1147941(-) (ssb) [Serratia marcescens strain WVU-010]
ATGGCTAGCAAAGGCATCAACAAAGCAATCATCATCGGCAACCTTGGGAAAGACCCAGAGGTTCGCTACACGCAAAATGG
TGGAGCAATCGCCAACCTGACGATTGCCACCTCTGAATCGTGGCGTGATAAACAATCTGGCGAGCAAAAGGAAAAGACTG
AATGGCACCGCGTGGTGCTGTTTGGAAAGCTGGCTGAAGTTGCCGGTGAGTATCTTCGAAAAGGCTCGCAGGTTTATATC
GAAGGGAGGCTGACAACGCGCAAGTGGGAAGATCAGGCTGGAGTCGAGCGATATACGACAGAGATTCATGTCAATGTCGG
CGGTGTGATGCAGATGATTGGCAGCAAGCAAGAAGCATCACAATCTGGCAATCAGCCGTCACCACCTAAGCAGCAAAATA
AACCACAACCGTCGAATGAGCCACCTATGGACTTCGACGACGACATTCCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

60.452

100

0.709

  ssb Glaesserella parasuis strain SC1401

50.276

100

0.603

  ssb Neisseria gonorrhoeae MS11

40.449

100

0.477

  ssb Neisseria meningitidis MC58

39.773

100

0.464


Multiple sequence alignment