Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   FG169_RS05480 Genome accession   NZ_CP041125
Coordinates   1148127..1148582 (-) Length   151 a.a.
NCBI ID   WP_141958182.1    Uniprot ID   -
Organism   Serratia marcescens strain WVU-004     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1138678..1181642 1148127..1148582 within 0


Gene organization within MGE regions


Location: 1138678..1181642
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FG169_RS05370 (FG169_05370) ybcJ 1138678..1138890 (-) 213 WP_049278727.1 ribosome-associated protein YbcJ -
  FG169_RS05375 (FG169_05375) folD 1138901..1139767 (-) 867 WP_004940177.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  FG169_RS05380 (FG169_05380) - 1139973..1140182 (+) 210 WP_060442520.1 hypothetical protein -
  FG169_RS05390 (FG169_05390) - 1140697..1141818 (-) 1122 WP_141958154.1 site-specific integrase -
  FG169_RS25640 - 1141953..1142045 (-) 93 Protein_1031 helix-turn-helix domain-containing protein -
  FG169_RS05400 (FG169_05400) - 1142052..1142243 (-) 192 WP_141958157.1 hypothetical protein -
  FG169_RS05405 (FG169_05405) - 1142240..1142449 (-) 210 WP_141958159.1 hypothetical protein -
  FG169_RS05410 (FG169_05410) - 1142442..1142663 (-) 222 WP_141958161.1 hypothetical protein -
  FG169_RS05415 (FG169_05415) - 1142734..1142988 (-) 255 WP_141958163.1 DNA polymerase III subunit theta -
  FG169_RS05420 (FG169_05420) - 1142998..1143258 (-) 261 WP_060429108.1 hypothetical protein -
  FG169_RS05425 (FG169_05425) - 1143316..1143933 (-) 618 WP_141958165.1 hypothetical protein -
  FG169_RS05430 (FG169_05430) - 1144103..1144324 (-) 222 WP_141958168.1 hypothetical protein -
  FG169_RS05435 (FG169_05435) - 1144326..1144751 (-) 426 WP_141958170.1 hypothetical protein -
  FG169_RS05440 (FG169_05440) - 1144741..1144941 (-) 201 WP_141958172.1 hypothetical protein -
  FG169_RS05445 (FG169_05445) - 1144938..1145153 (-) 216 WP_141958174.1 hypothetical protein -
  FG169_RS05450 (FG169_05450) - 1145146..1145406 (-) 261 WP_141958176.1 hypothetical protein -
  FG169_RS05455 (FG169_05455) - 1145399..1146295 (-) 897 WP_141958178.1 phosphoadenosine phosphosulfate reductase family protein -
  FG169_RS05460 (FG169_05460) - 1146282..1146818 (-) 537 WP_260439595.1 SAM-dependent methyltransferase -
  FG169_RS05465 (FG169_05465) - 1146815..1147582 (-) 768 WP_260440042.1 hypothetical protein -
  FG169_RS05475 (FG169_05475) - 1147767..1148099 (-) 333 WP_141958180.1 hypothetical protein -
  FG169_RS05480 (FG169_05480) ssb 1148127..1148582 (-) 456 WP_141958182.1 single-stranded DNA-binding protein Machinery gene
  FG169_RS05485 (FG169_05485) - 1148583..1149209 (-) 627 WP_141958185.1 ERF family protein -
  FG169_RS25490 - 1149218..1149388 (-) 171 WP_185741765.1 hypothetical protein -
  FG169_RS05490 (FG169_05490) - 1149498..1149629 (-) 132 WP_141958187.1 protease FtsH-inhibitory lysogeny factor CIII -
  FG169_RS05495 (FG169_05495) - 1149786..1150025 (-) 240 WP_141958189.1 hypothetical protein -
  FG169_RS05500 (FG169_05500) - 1150145..1150342 (-) 198 WP_141958191.1 hypothetical protein -
  FG169_RS05505 (FG169_05505) - 1150360..1150608 (-) 249 WP_071883557.1 hypothetical protein -
  FG169_RS05510 (FG169_05510) - 1151232..1151966 (-) 735 WP_141958193.1 helix-turn-helix transcriptional regulator -
  FG169_RS05515 (FG169_05515) - 1152084..1152311 (+) 228 WP_060430772.1 YdaS family helix-turn-helix protein -
  FG169_RS05520 (FG169_05520) - 1152421..1152699 (+) 279 WP_004940137.1 CII family transcriptional regulator -
  FG169_RS25495 - 1152734..1152898 (+) 165 WP_165877134.1 hypothetical protein -
  FG169_RS05525 (FG169_05525) - 1152885..1153784 (+) 900 WP_141958195.1 DNA replication protein -
  FG169_RS05530 (FG169_05530) - 1153771..1155183 (+) 1413 WP_141958197.1 DnaB-like helicase C-terminal domain-containing protein -
  FG169_RS05535 (FG169_05535) - 1155207..1155446 (+) 240 WP_141958199.1 hypothetical protein -
  FG169_RS05540 (FG169_05540) - 1155450..1155689 (+) 240 WP_141958201.1 DUF3850 domain-containing protein -
  FG169_RS05545 (FG169_05545) - 1155692..1156144 (+) 453 WP_141958203.1 recombination protein NinB -
  FG169_RS05550 (FG169_05550) - 1156171..1156311 (+) 141 WP_260440043.1 NinE family protein -
  FG169_RS05555 (FG169_05555) - 1156308..1156499 (+) 192 WP_141958208.1 hypothetical protein -
  FG169_RS05560 (FG169_05560) - 1156859..1156987 (+) 129 WP_141958210.1 protein NinF -
  FG169_RS05565 (FG169_05565) - 1156980..1157561 (+) 582 WP_141958212.1 recombination protein NinG -
  FG169_RS05570 (FG169_05570) - 1157909..1158400 (+) 492 WP_141958214.1 antiterminator Q family protein -
  FG169_RS05580 (FG169_05580) - 1159151..1159483 (+) 333 WP_004940112.1 phage holin, lambda family -
  FG169_RS05585 (FG169_05585) - 1159467..1159901 (+) 435 WP_141958216.1 lysozyme -
  FG169_RS05590 (FG169_05590) - 1159898..1160365 (+) 468 WP_141958218.1 lysis protein -
  FG169_RS05595 (FG169_05595) - 1160377..1160625 (+) 249 WP_141958220.1 hypothetical protein -
  FG169_RS05600 (FG169_05600) - 1160699..1160935 (+) 237 WP_141958222.1 DUF2560 family protein -
  FG169_RS05605 (FG169_05605) - 1160937..1161461 (+) 525 WP_226908233.1 hypothetical protein -
  FG169_RS25500 - 1161436..1161585 (+) 150 WP_185741766.1 hypothetical protein -
  FG169_RS05610 (FG169_05610) - 1161585..1161917 (+) 333 WP_141958224.1 DUF1737 domain-containing protein -
  FG169_RS05615 (FG169_05615) - 1161920..1162360 (+) 441 WP_141958226.1 terminase -
  FG169_RS05620 (FG169_05620) - 1162357..1163769 (+) 1413 WP_141958228.1 PBSX family phage terminase large subunit -
  FG169_RS05625 (FG169_05625) - 1163772..1165898 (+) 2127 WP_141958230.1 portal protein -
  FG169_RS05630 (FG169_05630) - 1165912..1166796 (+) 885 WP_141958232.1 phage capsid protein -
  FG169_RS05635 (FG169_05635) - 1166808..1168082 (+) 1275 WP_141958234.1 P22 phage major capsid protein family protein -
  FG169_RS05640 (FG169_05640) - 1168122..1168307 (+) 186 WP_141958236.1 hypothetical protein -
  FG169_RS05645 (FG169_05645) - 1168282..1168764 (+) 483 WP_004940081.1 packaged DNA stabilization gp4 family protein -
  FG169_RS05650 (FG169_05650) - 1168772..1170199 (+) 1428 WP_141958238.1 packaged DNA stabilization protein -
  FG169_RS05655 (FG169_05655) - 1170202..1170696 (+) 495 WP_141958240.1 HNH endonuclease -
  FG169_RS05660 (FG169_05660) - 1170696..1171604 (+) 909 WP_260439737.1 phage tail protein -
  FG169_RS05665 (FG169_05665) - 1171604..1172062 (+) 459 WP_141958244.1 DUF2824 family protein -
  FG169_RS05670 (FG169_05670) - 1172073..1172771 (+) 699 WP_141958246.1 DNA transfer protein -
  FG169_RS05675 (FG169_05675) - 1172771..1174225 (+) 1455 WP_141958249.1 phage DNA ejection protein -
  FG169_RS05680 (FG169_05680) - 1174225..1176012 (+) 1788 WP_141958251.1 DNA transfer protein -
  FG169_RS05685 (FG169_05685) - 1176203..1176679 (-) 477 WP_141958253.1 hypothetical protein -
  FG169_RS05690 (FG169_05690) - 1176682..1177083 (-) 402 WP_141958255.1 hypothetical protein -
  FG169_RS05695 (FG169_05695) - 1177083..1177322 (-) 240 WP_141958257.1 Arc family DNA-binding protein -
  FG169_RS25645 - 1177824..1180049 (+) 2226 WP_260440044.1 phage tailspike protein -
  FG169_RS05705 (FG169_05705) - 1180437..1181642 (+) 1206 WP_141958260.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 151 a.a.        Molecular weight: 16787.77 Da        Isoelectric Point: 6.4853

>NTDB_id=369526 FG169_RS05480 WP_141958182.1 1148127..1148582(-) (ssb) [Serratia marcescens strain WVU-004]
MASKGINKAIIIGNLGKDPEVRYTQNGGAIANLTIATSESWRDKQSGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGRLTTRKWEDQAGVERYTTEIHVNVGGVMQMIGSKQEASQSGNQPSPPKQQNKPQPSNEPPMDFDDDIPF

Nucleotide


Download         Length: 456 bp        

>NTDB_id=369526 FG169_RS05480 WP_141958182.1 1148127..1148582(-) (ssb) [Serratia marcescens strain WVU-004]
ATGGCTAGCAAAGGCATCAACAAAGCAATCATCATCGGCAACCTTGGGAAAGACCCAGAGGTTCGCTACACGCAAAATGG
TGGAGCAATCGCCAACCTGACGATTGCCACCTCTGAATCGTGGCGTGATAAACAATCTGGCGAGCAAAAGGAAAAGACTG
AATGGCACCGCGTGGTGCTGTTTGGAAAGCTGGCTGAAGTTGCCGGTGAGTATCTTCGAAAAGGCTCGCAGGTTTATATC
GAAGGGAGGCTGACAACGCGCAAGTGGGAAGATCAGGCTGGAGTCGAGCGATATACGACAGAGATTCATGTCAATGTCGG
CGGTGTGATGCAGATGATTGGCAGCAAGCAAGAAGCATCACAATCTGGCAATCAGCCGTCACCACCTAAGCAGCAAAATA
AACCACAACCGTCGAATGAGCCACCTATGGACTTCGACGACGACATTCCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

60.452

100

0.709

  ssb Glaesserella parasuis strain SC1401

50.276

100

0.603

  ssb Neisseria gonorrhoeae MS11

40.449

100

0.477

  ssb Neisseria meningitidis MC58

39.773

100

0.464


Multiple sequence alignment