Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | FH041_RS08975 | Genome accession | NZ_CP040930 |
| Coordinates | 1975149..1975646 (+) | Length | 165 a.a. |
| NCBI ID | WP_023535856.1 | Uniprot ID | - |
| Organism | Pseudomonas sp. SWI7 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1941876..1982783 | 1975149..1975646 | within | 0 |
Gene organization within MGE regions
Location: 1941876..1982783
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FH041_RS08760 (FH041_08760) | - | 1941876..1943057 (+) | 1182 | WP_140174400.1 | tyrosine-type recombinase/integrase | - |
| FH041_RS08765 (FH041_08765) | - | 1943042..1943416 (-) | 375 | WP_140174401.1 | LexA family transcriptional regulator | - |
| FH041_RS08770 (FH041_08770) | - | 1943484..1943708 (-) | 225 | WP_140174402.1 | hypothetical protein | - |
| FH041_RS08775 (FH041_08775) | - | 1943720..1944229 (-) | 510 | WP_140174403.1 | DUF2514 family protein | - |
| FH041_RS08780 (FH041_08780) | - | 1944226..1944714 (-) | 489 | WP_140174404.1 | glycoside hydrolase family protein | - |
| FH041_RS08785 (FH041_08785) | - | 1944823..1945032 (-) | 210 | WP_140174405.1 | hypothetical protein | - |
| FH041_RS08790 (FH041_08790) | - | 1945298..1946998 (+) | 1701 | WP_140174406.1 | hypothetical protein | - |
| FH041_RS08795 (FH041_08795) | - | 1947025..1949772 (-) | 2748 | WP_140174407.1 | right-handed parallel beta-helix repeat-containing protein | - |
| FH041_RS08800 (FH041_08800) | - | 1949832..1950452 (-) | 621 | WP_140174408.1 | hypothetical protein | - |
| FH041_RS08805 (FH041_08805) | - | 1950449..1951177 (-) | 729 | WP_140174409.1 | hypothetical protein | - |
| FH041_RS08810 (FH041_08810) | - | 1951177..1952148 (-) | 972 | WP_140174410.1 | hypothetical protein | - |
| FH041_RS08815 (FH041_08815) | - | 1952145..1957778 (-) | 5634 | WP_257225425.1 | tape measure protein | - |
| FH041_RS08820 (FH041_08820) | - | 1957814..1957975 (-) | 162 | WP_161631449.1 | hypothetical protein | - |
| FH041_RS08825 (FH041_08825) | - | 1958023..1958412 (-) | 390 | WP_140174412.1 | hypothetical protein | - |
| FH041_RS08830 (FH041_08830) | - | 1958481..1958954 (-) | 474 | WP_023535505.1 | phage tail tube protein | - |
| FH041_RS08835 (FH041_08835) | - | 1959010..1959393 (-) | 384 | WP_140174413.1 | DUF3168 domain-containing protein | - |
| FH041_RS08840 (FH041_08840) | - | 1959395..1959886 (-) | 492 | WP_140174414.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FH041_RS08845 (FH041_08845) | - | 1959888..1960070 (-) | 183 | WP_140174415.1 | hypothetical protein | - |
| FH041_RS08850 (FH041_08850) | - | 1960081..1960407 (-) | 327 | WP_140174416.1 | phage head closure protein | - |
| FH041_RS08855 (FH041_08855) | - | 1960407..1960706 (-) | 300 | WP_140174417.1 | head-tail connector protein | - |
| FH041_RS08860 (FH041_08860) | - | 1960707..1960925 (-) | 219 | WP_023535478.1 | hypothetical protein | - |
| FH041_RS08865 (FH041_08865) | - | 1960977..1962179 (-) | 1203 | WP_023535494.1 | phage major capsid protein | - |
| FH041_RS08870 (FH041_08870) | - | 1962176..1962817 (-) | 642 | WP_023535512.1 | HK97 family phage prohead protease | - |
| FH041_RS08875 (FH041_08875) | - | 1962804..1964018 (-) | 1215 | WP_140174418.1 | phage portal protein | - |
| FH041_RS08880 (FH041_08880) | - | 1964021..1965709 (-) | 1689 | WP_140174419.1 | terminase large subunit | - |
| FH041_RS08885 (FH041_08885) | - | 1965706..1966251 (-) | 546 | WP_140174420.1 | terminase small subunit | - |
| FH041_RS08890 (FH041_08890) | - | 1966415..1966750 (-) | 336 | WP_140174421.1 | HNH endonuclease | - |
| FH041_RS08895 (FH041_08895) | - | 1966750..1967031 (-) | 282 | WP_140174422.1 | phage holin family protein | - |
| FH041_RS08900 (FH041_08900) | - | 1967032..1967406 (-) | 375 | WP_140174423.1 | putative holin | - |
| FH041_RS08905 (FH041_08905) | - | 1967536..1967877 (-) | 342 | WP_023535490.1 | antiterminator Q family protein | - |
| FH041_RS08910 (FH041_08910) | - | 1967887..1968204 (-) | 318 | WP_140174424.1 | hypothetical protein | - |
| FH041_RS08915 (FH041_08915) | - | 1968201..1968488 (-) | 288 | WP_140174425.1 | hypothetical protein | - |
| FH041_RS08920 (FH041_08920) | - | 1968485..1969774 (-) | 1290 | WP_140174426.1 | site-specific integrase | - |
| FH041_RS08925 (FH041_08925) | - | 1969771..1970199 (-) | 429 | WP_140174427.1 | VRR-NUC domain-containing protein | - |
| FH041_RS08930 (FH041_08930) | - | 1970196..1970492 (-) | 297 | WP_140174428.1 | DUF1364 domain-containing protein | - |
| FH041_RS08935 (FH041_08935) | - | 1970495..1971307 (-) | 813 | WP_140174429.1 | ATP-binding protein | - |
| FH041_RS08940 (FH041_08940) | - | 1971297..1972154 (-) | 858 | WP_140174430.1 | replication protein | - |
| FH041_RS08945 (FH041_08945) | - | 1972301..1972501 (-) | 201 | WP_140174431.1 | hypothetical protein | - |
| FH041_RS08950 (FH041_08950) | - | 1972600..1973256 (+) | 657 | WP_140174432.1 | LexA family transcriptional regulator | - |
| FH041_RS08955 (FH041_08955) | - | 1973592..1974029 (+) | 438 | WP_103469392.1 | tellurite resistance TerB family protein | - |
| FH041_RS08960 (FH041_08960) | - | 1974026..1974220 (+) | 195 | WP_140174433.1 | hypothetical protein | - |
| FH041_RS08965 (FH041_08965) | - | 1974411..1974794 (+) | 384 | WP_023535468.1 | response regulator transcription factor | - |
| FH041_RS08970 (FH041_08970) | - | 1974814..1975152 (+) | 339 | WP_140174434.1 | hypothetical protein | - |
| FH041_RS08975 (FH041_08975) | ssb | 1975149..1975646 (+) | 498 | WP_023535856.1 | single-stranded DNA-binding protein | Machinery gene |
| FH041_RS22735 | - | 1975649..1975813 (+) | 165 | WP_168199529.1 | hypothetical protein | - |
| FH041_RS08980 (FH041_08980) | - | 1975895..1976143 (+) | 249 | WP_140174435.1 | hypothetical protein | - |
| FH041_RS08985 (FH041_08985) | - | 1976241..1976855 (-) | 615 | WP_140174436.1 | hypothetical protein | - |
| FH041_RS08990 (FH041_08990) | - | 1976960..1977511 (+) | 552 | WP_230375094.1 | hypothetical protein | - |
| FH041_RS22740 | - | 1977586..1977756 (-) | 171 | WP_168199530.1 | hypothetical protein | - |
| FH041_RS08995 (FH041_08995) | - | 1977879..1978886 (+) | 1008 | WP_140174438.1 | DNA cytosine methyltransferase | - |
| FH041_RS09005 (FH041_09005) | - | 1979437..1979640 (-) | 204 | WP_140174439.1 | hypothetical protein | - |
| FH041_RS22860 | - | 1980152..1980424 (+) | 273 | WP_177438163.1 | hypothetical protein | - |
| FH041_RS09015 (FH041_09015) | - | 1980421..1980717 (+) | 297 | WP_140174441.1 | hypothetical protein | - |
| FH041_RS09020 (FH041_09020) | - | 1980714..1981007 (+) | 294 | WP_140174442.1 | hypothetical protein | - |
| FH041_RS09025 (FH041_09025) | - | 1981004..1981195 (+) | 192 | WP_140174443.1 | DUF551 domain-containing protein | - |
| FH041_RS09030 (FH041_09030) | - | 1981192..1981611 (+) | 420 | WP_140174444.1 | phage protein NinX family protein | - |
| FH041_RS09035 (FH041_09035) | - | 1981650..1982087 (+) | 438 | WP_140175111.1 | class I SAM-dependent methyltransferase | - |
| FH041_RS09040 (FH041_09040) | - | 1982139..1982372 (+) | 234 | WP_140174445.1 | hypothetical protein | - |
| FH041_RS22745 | - | 1982369..1982545 (+) | 177 | WP_168199531.1 | hypothetical protein | - |
| FH041_RS09045 (FH041_09045) | - | 1982571..1982783 (+) | 213 | WP_132579024.1 | AlpA family transcriptional regulator | - |
Sequence
Protein
Download Length: 165 a.a. Molecular weight: 18467.67 Da Isoelectric Point: 7.8422
>NTDB_id=368369 FH041_RS08975 WP_023535856.1 1975149..1975646(+) (ssb) [Pseudomonas sp. SWI7]
MSRGVNKVILVGTCGQDPEVRYLPNGNAVTNLSLATSEQWLDKRSGQKVERTEWHRVSLFGKVAEIAGEYLRKGAQCYIE
GKLQTREWEKDGIKRYTTEIIVDINGTMQMLGSRPQGQQAGYPPDRQPQQQRQARQSTSQQAAPPNSDSFDDDIPFAPMH
YLAGG
MSRGVNKVILVGTCGQDPEVRYLPNGNAVTNLSLATSEQWLDKRSGQKVERTEWHRVSLFGKVAEIAGEYLRKGAQCYIE
GKLQTREWEKDGIKRYTTEIIVDINGTMQMLGSRPQGQQAGYPPDRQPQQQRQARQSTSQQAAPPNSDSFDDDIPFAPMH
YLAGG
Nucleotide
Download Length: 498 bp
>NTDB_id=368369 FH041_RS08975 WP_023535856.1 1975149..1975646(+) (ssb) [Pseudomonas sp. SWI7]
ATGAGCCGCGGAGTAAACAAGGTCATCCTGGTAGGCACCTGCGGCCAGGATCCGGAAGTGCGGTACCTGCCCAATGGCAA
CGCGGTTACCAACCTCAGCCTGGCAACCAGCGAGCAATGGCTGGACAAGCGCTCAGGCCAGAAGGTGGAGCGCACCGAGT
GGCACCGTGTGTCCCTGTTCGGGAAAGTTGCCGAGATTGCAGGCGAGTACCTGCGTAAAGGCGCTCAGTGCTACATCGAG
GGCAAGCTGCAAACCCGCGAGTGGGAGAAAGATGGCATCAAGCGCTACACCACGGAAATCATCGTGGACATCAACGGCAC
GATGCAGATGCTGGGCAGCCGACCGCAGGGCCAGCAAGCCGGGTATCCGCCTGACAGGCAGCCTCAGCAACAGCGCCAGG
CGCGGCAGTCGACGAGCCAGCAGGCAGCACCACCGAATAGCGATAGCTTCGACGACGACATACCGTTCGCGCCGATGCAT
TACCTCGCAGGAGGATGA
ATGAGCCGCGGAGTAAACAAGGTCATCCTGGTAGGCACCTGCGGCCAGGATCCGGAAGTGCGGTACCTGCCCAATGGCAA
CGCGGTTACCAACCTCAGCCTGGCAACCAGCGAGCAATGGCTGGACAAGCGCTCAGGCCAGAAGGTGGAGCGCACCGAGT
GGCACCGTGTGTCCCTGTTCGGGAAAGTTGCCGAGATTGCAGGCGAGTACCTGCGTAAAGGCGCTCAGTGCTACATCGAG
GGCAAGCTGCAAACCCGCGAGTGGGAGAAAGATGGCATCAAGCGCTACACCACGGAAATCATCGTGGACATCAACGGCAC
GATGCAGATGCTGGGCAGCCGACCGCAGGGCCAGCAAGCCGGGTATCCGCCTGACAGGCAGCCTCAGCAACAGCGCCAGG
CGCGGCAGTCGACGAGCCAGCAGGCAGCACCACCGAATAGCGATAGCTTCGACGACGACATACCGTTCGCGCCGATGCAT
TACCTCGCAGGAGGATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
53.714 |
100 |
0.57 |
| ssb | Glaesserella parasuis strain SC1401 |
45.902 |
100 |
0.509 |
| ssb | Neisseria meningitidis MC58 |
44.068 |
100 |
0.473 |
| ssb | Neisseria gonorrhoeae MS11 |
44.068 |
100 |
0.473 |