Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   SLIT_RS09830 Genome accession   NC_013959
Coordinates   1981136..1981624 (+) Length   162 a.a.
NCBI ID   WP_013030092.1    Uniprot ID   D5CTA8
Organism   Sideroxydans lithotrophicus ES-1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1930250..1983955 1981136..1981624 within 0


Gene organization within MGE regions


Location: 1930250..1983955
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SLIT_RS09475 (Slit_1889) - 1930250..1930810 (-) 561 WP_190272126.1 transglycosylase SLT domain-containing protein -
  SLIT_RS09480 (Slit_1890) - 1930861..1931178 (-) 318 WP_013030017.1 DUF6527 family protein -
  SLIT_RS09485 (Slit_1891) - 1931175..1931438 (-) 264 WP_013030018.1 phage-related membrane protein -
  SLIT_RS09490 (Slit_1892) - 1931442..1931651 (-) 210 WP_013030019.1 hypothetical protein -
  SLIT_RS09495 (Slit_1893) - 1931654..1932130 (-) 477 WP_013030020.1 hypothetical protein -
  SLIT_RS09500 (Slit_1894) - 1932123..1932416 (-) 294 WP_013030021.1 hypothetical protein -
  SLIT_RS15270 (Slit_1895) - 1932482..1932919 (-) 438 WP_013030022.1 hypothetical protein -
  SLIT_RS15275 (Slit_1896) - 1932929..1934260 (-) 1332 WP_049870983.1 gp53-like domain-containing protein -
  SLIT_RS09515 (Slit_1897) - 1934327..1934911 (-) 585 WP_223293786.1 hypothetical protein -
  SLIT_RS09520 (Slit_1898) - 1935009..1936130 (-) 1122 WP_013030025.1 baseplate J/gp47 family protein -
  SLIT_RS09525 (Slit_1899) - 1936132..1936527 (-) 396 WP_013030026.1 hypothetical protein -
  SLIT_RS09530 (Slit_1900) - 1936527..1937114 (-) 588 WP_013030027.1 phage baseplate assembly protein V -
  SLIT_RS09535 (Slit_1901) - 1937111..1938118 (-) 1008 WP_150102987.1 hypothetical protein -
  SLIT_RS09540 (Slit_1902) - 1938229..1939014 (-) 786 WP_013030029.1 hypothetical protein -
  SLIT_RS09545 (Slit_1903) - 1939017..1940780 (-) 1764 WP_041420836.1 hypothetical protein -
  SLIT_RS15960 - 1940839..1941090 (+) 252 WP_150102988.1 hypothetical protein -
  SLIT_RS09550 (Slit_1904) - 1941054..1941557 (-) 504 WP_013030031.1 HK97-gp10 family putative phage morphogenesis protein -
  SLIT_RS09555 (Slit_1906) - 1941717..1942085 (-) 369 WP_013030033.1 hypothetical protein -
  SLIT_RS09560 (Slit_1907) - 1942089..1942520 (-) 432 WP_013030034.1 hypothetical protein -
  SLIT_RS09565 (Slit_1908) - 1942579..1944114 (-) 1536 WP_013030035.1 phage tail protein -
  SLIT_RS16110 (Slit_1909) - 1944179..1944331 (-) 153 WP_013030036.1 hypothetical protein -
  SLIT_RS09570 (Slit_1910) - 1944344..1945216 (-) 873 WP_013030037.1 hypothetical protein -
  SLIT_RS09575 - 1945209..1945403 (-) 195 WP_041420837.1 hypothetical protein -
  SLIT_RS09580 (Slit_1911) - 1945406..1945756 (-) 351 WP_013030038.1 hypothetical protein -
  SLIT_RS09585 (Slit_1912) - 1945760..1946608 (-) 849 WP_150102989.1 hypothetical protein -
  SLIT_RS09590 (Slit_1913) - 1946700..1946969 (-) 270 WP_013030040.1 hypothetical protein -
  SLIT_RS15965 (Slit_1914) - 1946966..1947199 (-) 234 WP_013030041.1 hypothetical protein -
  SLIT_RS09595 (Slit_1915) - 1947274..1948278 (-) 1005 WP_013030042.1 hypothetical protein -
  SLIT_RS09600 (Slit_1916) - 1948307..1949713 (-) 1407 WP_013030043.1 DUF6582 domain-containing protein -
  SLIT_RS09605 (Slit_1917) - 1949777..1950280 (-) 504 WP_013030044.1 hypothetical protein -
  SLIT_RS09610 (Slit_1918) - 1950291..1950512 (-) 222 WP_013030045.1 hypothetical protein -
  SLIT_RS09615 (Slit_1919) - 1950515..1950730 (-) 216 WP_013030046.1 hypothetical protein -
  SLIT_RS09620 (Slit_1920) - 1950762..1951070 (-) 309 WP_013030047.1 hypothetical protein -
  SLIT_RS09625 (Slit_1921) - 1951060..1952406 (-) 1347 WP_013030048.1 phage portal protein -
  SLIT_RS09630 (Slit_1922) terL 1952423..1953778 (-) 1356 WP_190272127.1 phage terminase large subunit -
  SLIT_RS09635 (Slit_1923) - 1953852..1954328 (-) 477 WP_013030050.1 DUF2280 domain-containing protein -
  SLIT_RS09640 (Slit_1924) - 1954361..1955017 (-) 657 WP_041420838.1 putative metallopeptidase -
  SLIT_RS09645 (Slit_1925) - 1955437..1955715 (-) 279 WP_013030052.1 hypothetical protein -
  SLIT_RS09650 (Slit_1926) - 1955712..1956083 (-) 372 WP_013030053.1 hypothetical protein -
  SLIT_RS15970 (Slit_1927) - 1956080..1956274 (-) 195 WP_013030054.1 hypothetical protein -
  SLIT_RS09660 (Slit_1929) - 1956381..1956611 (-) 231 WP_013030056.1 hypothetical protein -
  SLIT_RS09665 (Slit_1930) - 1956608..1957039 (-) 432 WP_013030057.1 RusA family crossover junction endodeoxyribonuclease -
  SLIT_RS09670 (Slit_1931) - 1957036..1957395 (-) 360 WP_150102990.1 hypothetical protein -
  SLIT_RS09685 (Slit_1934) - 1957768..1958307 (-) 540 WP_013030061.1 DUF1367 family protein -
  SLIT_RS09690 (Slit_1935) - 1958304..1958954 (-) 651 WP_013030062.1 DUF6475 domain-containing protein -
  SLIT_RS15280 (Slit_1936) - 1958941..1959687 (-) 747 WP_013030063.1 hypothetical protein -
  SLIT_RS09700 (Slit_1937) - 1959690..1962221 (-) 2532 WP_013030064.1 DNA methyltransferase -
  SLIT_RS09705 (Slit_1938) - 1962218..1962520 (-) 303 WP_013030065.1 hypothetical protein -
  SLIT_RS09710 (Slit_1939) - 1962517..1962900 (-) 384 WP_013030066.1 hypothetical protein -
  SLIT_RS09715 (Slit_1940) - 1963055..1963294 (-) 240 WP_041421213.1 helix-turn-helix domain-containing protein -
  SLIT_RS09720 (Slit_1941) - 1963375..1963731 (+) 357 WP_150102991.1 helix-turn-helix transcriptional regulator -
  SLIT_RS09725 (Slit_1942) - 1963785..1964264 (+) 480 WP_041420839.1 hypothetical protein -
  SLIT_RS09730 (Slit_1943) - 1964261..1964713 (+) 453 WP_013030070.1 hypothetical protein -
  SLIT_RS15975 (Slit_1944) - 1965201..1965455 (+) 255 WP_013030071.1 hypothetical protein -
  SLIT_RS16290 (Slit_1945) - 1965555..1965686 (+) 132 WP_013030072.1 hypothetical protein -
  SLIT_RS09735 (Slit_1946) - 1966027..1966938 (+) 912 WP_013030073.1 hypothetical protein -
  SLIT_RS09740 (Slit_1947) - 1967008..1968000 (+) 993 WP_013030074.1 hypothetical protein -
  SLIT_RS09745 (Slit_1948) - 1968003..1969691 (+) 1689 WP_013030075.1 lambda-exonuclease family protein -
  SLIT_RS09750 (Slit_1949) - 1969720..1970004 (+) 285 WP_013030076.1 KTSC domain-containing protein -
  SLIT_RS09755 (Slit_1950) - 1970004..1970474 (+) 471 WP_013030077.1 hypothetical protein -
  SLIT_RS09760 (Slit_1951) - 1970490..1971515 (+) 1026 WP_013030078.1 hypothetical protein -
  SLIT_RS09765 (Slit_1952) - 1971567..1972412 (+) 846 WP_013030079.1 hypothetical protein -
  SLIT_RS09770 (Slit_1953) - 1972748..1973683 (+) 936 WP_013030080.1 RNA-directed DNA polymerase -
  SLIT_RS09775 (Slit_1954) - 1973737..1973922 (+) 186 WP_150102992.1 hypothetical protein -
  SLIT_RS09780 (Slit_1955) - 1973916..1975745 (+) 1830 WP_013030082.1 DNA cytosine methyltransferase -
  SLIT_RS09785 (Slit_1956) - 1975742..1976965 (+) 1224 WP_013030083.1 phosphoadenosine phosphosulfate reductase family protein -
  SLIT_RS09790 (Slit_1957) - 1976962..1977558 (+) 597 WP_013030084.1 hypothetical protein -
  SLIT_RS09795 (Slit_1958) - 1977555..1977911 (+) 357 WP_013030085.1 hypothetical protein -
  SLIT_RS09800 (Slit_1959) - 1977904..1978899 (+) 996 WP_013030086.1 phage Gp37/Gp68 family protein -
  SLIT_RS09805 (Slit_1960) - 1978896..1979390 (+) 495 WP_013030087.1 DUF1643 domain-containing protein -
  SLIT_RS09810 (Slit_1961) - 1979557..1979949 (+) 393 WP_013030088.1 zinc-finger-containing protein -
  SLIT_RS09815 (Slit_1962) - 1979946..1980509 (+) 564 WP_013030089.1 hypothetical protein -
  SLIT_RS09820 (Slit_1963) - 1980506..1980766 (+) 261 WP_013030090.1 DUF4031 domain-containing protein -
  SLIT_RS09825 (Slit_1964) - 1980747..1981049 (+) 303 WP_013030091.1 hypothetical protein -
  SLIT_RS09830 (Slit_1965) ssb 1981136..1981624 (+) 489 WP_013030092.1 single-stranded DNA-binding protein Machinery gene
  SLIT_RS16390 (Slit_1968) - 1982046..1983620 (+) 1575 WP_013030095.1 recombinase family protein -

Sequence

Protein


Download         Length: 162 a.a.        Molecular weight: 18339.64 Da        Isoelectric Point: 7.3210

>NTDB_id=36742 SLIT_RS09830 WP_013030092.1 1981136..1981624(+) (ssb) [Sideroxydans lithotrophicus ES-1]
MSVNKVILIGRTGKDPEIRYMTNGEAVANFSLATSENWKDKSGEKQERTEWHNCVAYRRLAEVIGEYIKKGALLYIEGKI
QTRKWQDKETGKDRYTTEIIVNEMQMLGSKQSGEHHDGAEPAARPAPAAKPAAPAGKGNFDNFDDDIPFFESCRHYGLWR
SM

Nucleotide


Download         Length: 489 bp        

>NTDB_id=36742 SLIT_RS09830 WP_013030092.1 1981136..1981624(+) (ssb) [Sideroxydans lithotrophicus ES-1]
ATGAGCGTGAACAAAGTTATTTTGATTGGACGTACCGGCAAGGATCCTGAAATCCGTTACATGACCAACGGTGAAGCCGT
GGCGAACTTCTCGCTGGCAACCTCTGAAAACTGGAAGGACAAGAGCGGCGAGAAACAAGAACGGACTGAATGGCATAACT
GCGTAGCCTACCGTCGCCTCGCTGAGGTGATCGGCGAGTACATCAAGAAAGGCGCTCTGCTCTACATCGAGGGGAAAATC
CAGACGCGCAAATGGCAGGACAAGGAAACCGGAAAAGACCGCTACACCACTGAGATCATCGTCAACGAGATGCAGATGCT
GGGCAGCAAGCAAAGTGGTGAGCATCACGATGGCGCAGAACCAGCAGCGCGCCCTGCTCCGGCGGCAAAACCTGCGGCAC
CAGCAGGCAAGGGAAATTTCGATAACTTCGACGATGACATCCCGTTCTTTGAGTCCTGCCGTCACTATGGGCTGTGGAGG
TCGATGTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-107)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB D5CTA8

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Neisseria gonorrhoeae MS11

49.143

100

0.531
  ssb Glaesserella parasuis strain SC1401

47.486

100

0.525
  ssb Neisseria meningitidis MC58

48.571

100

0.525
  ssb Vibrio cholerae strain A1552

45.763

100

0.5

Multiple sequence alignment