Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | M594_RS10000 | Genome accession | NZ_CP047883 |
| Coordinates | 2083678..2083803 (-) | Length | 41 a.a. |
| NCBI ID | WP_049535516.1 | Uniprot ID | A0ABY2YM32 |
| Organism | Streptococcus mitis strain S022-V3-A4 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2078678..2088803
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M594_RS09975 (M594_10020) | - | 2080798..2081340 (+) | 543 | WP_173876721.1 | TetR/AcrR family transcriptional regulator | - |
| M594_RS09990 (M594_10035) | comE | 2081583..2082335 (-) | 753 | WP_000866074.1 | competence system response regulator transcription factor ComE | Regulator |
| M594_RS09995 (M594_10040) | comD/comD2 | 2082332..2083657 (-) | 1326 | WP_173876722.1 | competence system sensor histidine kinase ComD | Regulator |
| M594_RS10000 (M594_10045) | comC/comC2 | 2083678..2083803 (-) | 126 | WP_049535516.1 | competence-stimulating peptide ComC | Regulator |
| M594_RS10010 (M594_10055) | rlmH | 2084086..2084565 (-) | 480 | WP_042900048.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| M594_RS10015 (M594_10060) | htrA | 2084749..2085930 (+) | 1182 | WP_173876723.1 | S1C family serine protease | Regulator |
| M594_RS10020 (M594_10065) | spo0J | 2085988..2086746 (+) | 759 | WP_173876724.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4850.79 Da Isoelectric Point: 10.7877
>NTDB_id=366363 M594_RS10000 WP_049535516.1 2083678..2083803(-) (comC/comC2) [Streptococcus mitis strain S022-V3-A4]
MKNTVKLEQFVALKEKDLQKIKGGESRVSDILLDFLFRRKK
MKNTVKLEQFVALKEKDLQKIKGGESRVSDILLDFLFRRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=366363 M594_RS10000 WP_049535516.1 2083678..2083803(-) (comC/comC2) [Streptococcus mitis strain S022-V3-A4]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAAGTAG
GGTTTCAGACATCCTCCTTGATTTTCTTTTCCGACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAAGTAG
GGTTTCAGACATCCTCCTTGATTTTCTTTTCCGACGAAAAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
87.805 |
100 |
0.878 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
87.805 |
100 |
0.878 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |