Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLKF_RS11850 Genome accession   NC_013656
Coordinates   2410651..2410935 (-) Length   94 a.a.
NCBI ID   WP_012898619.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis KF147     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2405651..2415935
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLKF_RS11820 (LLKF_2360) - 2406092..2406469 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLKF_RS11825 (LLKF_2361) - 2406674..2407540 (+) 867 WP_012898615.1 RluA family pseudouridine synthase -
  LLKF_RS11830 (LLKF_2362) - 2407578..2408387 (-) 810 WP_012898616.1 metal ABC transporter permease -
  LLKF_RS11835 (LLKF_2363) - 2408380..2409117 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LLKF_RS11840 (LLKF_2364) - 2409294..2410136 (-) 843 WP_012898618.1 metal ABC transporter substrate-binding protein -
  LLKF_RS11845 (LLKF_2365) - 2410133..2410570 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  LLKF_RS11850 (LLKF_2366) comGG 2410651..2410935 (-) 285 WP_012898619.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLKF_RS11855 (LLKF_2367) comGF 2410974..2411420 (-) 447 WP_038603761.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLKF_RS11860 (LLKF_2368) comGE 2411383..2411679 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLKF_RS11865 (LLKF_2369) comGD 2411651..2412082 (-) 432 WP_012898621.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLKF_RS11870 (LLKF_2370) comGC 2412042..2412425 (-) 384 WP_012898622.1 competence type IV pilus major pilin ComGC Machinery gene
  LLKF_RS11875 (LLKF_2371) comGB 2412439..2413512 (-) 1074 WP_012898623.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLKF_RS11880 (LLKF_2372) comGA 2413406..2414344 (-) 939 WP_012898624.1 competence type IV pilus ATPase ComGA Machinery gene
  LLKF_RS11885 - 2414614..2414796 (-) 183 WP_038603763.1 hypothetical protein -
  LLKF_RS11890 (LLKF_2373) - 2414787..2415542 (-) 756 WP_012898625.1 hypothetical protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10826.14 Da        Isoelectric Point: 6.2158

>NTDB_id=35922 LLKF_RS11850 WP_012898619.1 2410651..2410935(-) (comGG) [Lactococcus lactis subsp. lactis KF147]
MFSMFLKFYLQRQIDDARQLRSEKEQLTAELMVSIALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGTNFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=35922 LLKF_RS11850 WP_012898619.1 2410651..2410935(-) (comGG) [Lactococcus lactis subsp. lactis KF147]
ATGTTTTCAATGTTTCTTAAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACTGCTGAATTAATGGTGTCGATAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585


Multiple sequence alignment