Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | E4184_RS09515 | Genome accession | NZ_CP038441 |
| Coordinates | 2038395..2038865 (-) | Length | 156 a.a. |
| NCBI ID | WP_171275975.1 | Uniprot ID | - |
| Organism | Aeromonas media strain T0.1-19 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2037049..2079811 | 2038395..2038865 | within | 0 |
Gene organization within MGE regions
Location: 2037049..2079811
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4184_RS09505 (E4184_09625) | - | 2037049..2038236 (+) | 1188 | WP_171275973.1 | site-specific integrase | - |
| E4184_RS09510 (E4184_09630) | - | 2038183..2038377 (-) | 195 | WP_171275974.1 | DNA-binding protein | - |
| E4184_RS09515 (E4184_09635) | ssb | 2038395..2038865 (-) | 471 | WP_171275975.1 | single-stranded DNA-binding protein | Machinery gene |
| E4184_RS09520 (E4184_09640) | - | 2038862..2039122 (-) | 261 | WP_171275976.1 | hypothetical protein | - |
| E4184_RS09525 (E4184_09645) | - | 2039132..2039551 (-) | 420 | WP_171275977.1 | hypothetical protein | - |
| E4184_RS23045 | - | 2039548..2041242 (-) | 1695 | WP_253265040.1 | phage N-6-adenine-methyltransferase | - |
| E4184_RS09535 (E4184_09655) | - | 2041239..2041481 (-) | 243 | WP_171275978.1 | helix-turn-helix transcriptional regulator | - |
| E4184_RS09540 (E4184_09660) | - | 2041478..2042056 (-) | 579 | WP_171275979.1 | 3'-5' exonuclease | - |
| E4184_RS09545 (E4184_09665) | - | 2042053..2042397 (-) | 345 | WP_171275980.1 | DUF4406 domain-containing protein | - |
| E4184_RS09550 (E4184_09670) | - | 2042517..2043434 (-) | 918 | WP_171275981.1 | BRCT domain-containing protein | - |
| E4184_RS09555 (E4184_09675) | - | 2043512..2043838 (-) | 327 | WP_171275982.1 | hypothetical protein | - |
| E4184_RS09560 (E4184_09680) | - | 2043864..2044544 (-) | 681 | WP_171275983.1 | WYL domain-containing protein | - |
| E4184_RS09565 (E4184_09685) | - | 2044557..2044922 (-) | 366 | WP_171275984.1 | hypothetical protein | - |
| E4184_RS09570 (E4184_09690) | - | 2044976..2045806 (-) | 831 | WP_171275985.1 | DUF3037 domain-containing protein | - |
| E4184_RS09575 (E4184_09695) | - | 2045803..2046591 (-) | 789 | WP_253265041.1 | HipA family kinase | - |
| E4184_RS09580 (E4184_09700) | - | 2046621..2047274 (-) | 654 | WP_171275987.1 | XRE family transcriptional regulator | - |
| E4184_RS09585 (E4184_09705) | - | 2047372..2047578 (+) | 207 | WP_042047491.1 | helix-turn-helix transcriptional regulator | - |
| E4184_RS09590 (E4184_09710) | - | 2047610..2048131 (+) | 522 | WP_234676912.1 | phage regulatory CII family protein | - |
| E4184_RS09595 (E4184_09715) | - | 2048131..2048424 (+) | 294 | WP_253265043.1 | hypothetical protein | - |
| E4184_RS09600 (E4184_09720) | - | 2048414..2048659 (+) | 246 | WP_171275988.1 | hypothetical protein | - |
| E4184_RS09605 (E4184_09725) | - | 2048718..2049773 (+) | 1056 | WP_253265044.1 | conserved phage C-terminal domain-containing protein | - |
| E4184_RS09610 (E4184_09730) | - | 2049751..2050245 (+) | 495 | WP_103857830.1 | hypothetical protein | - |
| E4184_RS09615 (E4184_09735) | - | 2050245..2050505 (+) | 261 | WP_113724886.1 | hypothetical protein | - |
| E4184_RS09620 (E4184_09740) | - | 2050502..2050729 (+) | 228 | WP_253265045.1 | hypothetical protein | - |
| E4184_RS09625 (E4184_09745) | - | 2050830..2051540 (+) | 711 | WP_041205556.1 | phage regulatory protein/antirepressor Ant | - |
| E4184_RS09630 (E4184_09750) | - | 2051537..2051734 (+) | 198 | WP_005324004.1 | DUF3283 family protein | - |
| E4184_RS09635 (E4184_09755) | - | 2051731..2052723 (+) | 993 | WP_234676918.1 | DUF968 domain-containing protein | - |
| E4184_RS09640 (E4184_09760) | - | 2052710..2053096 (+) | 387 | WP_171275990.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E4184_RS09645 (E4184_09765) | - | 2053093..2053596 (+) | 504 | WP_171275991.1 | hypothetical protein | - |
| E4184_RS09650 (E4184_09770) | - | 2053587..2053913 (+) | 327 | WP_171275992.1 | MFS transporter | - |
| E4184_RS09655 (E4184_09775) | - | 2053910..2054200 (+) | 291 | WP_171275993.1 | hypothetical protein | - |
| E4184_RS09660 (E4184_09780) | - | 2054206..2054688 (+) | 483 | WP_171275994.1 | lysozyme | - |
| E4184_RS09665 (E4184_09785) | - | 2054685..2055212 (+) | 528 | WP_171275995.1 | DUF2514 domain-containing protein | - |
| E4184_RS09670 (E4184_09790) | - | 2055351..2055872 (+) | 522 | WP_171275996.1 | terminase small subunit | - |
| E4184_RS09675 (E4184_09795) | - | 2055865..2057916 (+) | 2052 | WP_171275997.1 | terminase gpA endonuclease subunit | - |
| E4184_RS09680 (E4184_09800) | - | 2058039..2058455 (+) | 417 | WP_171275998.1 | hypothetical protein | - |
| E4184_RS09685 (E4184_09805) | - | 2058455..2060017 (+) | 1563 | WP_171275999.1 | phage portal protein | - |
| E4184_RS09690 (E4184_09810) | - | 2060004..2062064 (+) | 2061 | WP_216366603.1 | phage major capsid protein | - |
| E4184_RS09695 (E4184_09815) | - | 2062126..2062473 (+) | 348 | WP_171276000.1 | hypothetical protein | - |
| E4184_RS09700 (E4184_09820) | - | 2062582..2062830 (+) | 249 | WP_171276001.1 | hypothetical protein | - |
| E4184_RS09705 (E4184_09825) | - | 2062830..2063171 (+) | 342 | WP_171276002.1 | hypothetical protein | - |
| E4184_RS09710 (E4184_09830) | - | 2063158..2063706 (+) | 549 | WP_171276003.1 | phage tail protein | - |
| E4184_RS09715 (E4184_09835) | - | 2063703..2064380 (+) | 678 | WP_171276004.1 | hypothetical protein | - |
| E4184_RS09720 (E4184_09840) | - | 2064377..2064940 (+) | 564 | WP_171276005.1 | phage baseplate assembly protein V | - |
| E4184_RS09725 (E4184_09845) | - | 2064958..2065416 (+) | 459 | WP_240039925.1 | GPW/gp25 family protein | - |
| E4184_RS09730 (E4184_09850) | - | 2065427..2066917 (+) | 1491 | WP_171276006.1 | carbohydrate binding domain-containing protein | - |
| E4184_RS09735 (E4184_09855) | - | 2066914..2067231 (+) | 318 | WP_171276007.1 | hypothetical protein | - |
| E4184_RS09740 (E4184_09860) | - | 2067234..2067932 (+) | 699 | WP_171276008.1 | baseplate J/gp47 family protein | - |
| E4184_RS09745 (E4184_09865) | - | 2067944..2068975 (-) | 1032 | WP_001809438.1 | IS630-like element ISAhy2 family transposase | - |
| E4184_RS09750 | - | 2069138..2069293 (+) | 156 | WP_171276009.1 | hypothetical protein | - |
| E4184_RS09755 (E4184_09870) | - | 2069304..2069852 (+) | 549 | WP_284147330.1 | phage tail protein I | - |
| E4184_RS09760 (E4184_09875) | - | 2069852..2070790 (+) | 939 | WP_171276011.1 | hypothetical protein | - |
| E4184_RS09765 (E4184_09880) | - | 2070921..2072354 (+) | 1434 | WP_171276012.1 | phage tail sheath C-terminal domain-containing protein | - |
| E4184_RS09770 (E4184_09885) | - | 2072355..2072861 (+) | 507 | WP_171276013.1 | phage major tail tube protein | - |
| E4184_RS09775 (E4184_09890) | - | 2072913..2073197 (+) | 285 | WP_171276014.1 | phage tail assembly protein | - |
| E4184_RS09780 (E4184_09895) | - | 2073321..2075549 (+) | 2229 | WP_171276015.1 | phage tail tape measure protein | - |
| E4184_RS09785 (E4184_09900) | - | 2075556..2076464 (+) | 909 | WP_171276016.1 | phage tail protein | - |
| E4184_RS09790 (E4184_09905) | - | 2076461..2076673 (+) | 213 | WP_365827844.1 | tail protein X | - |
| E4184_RS09795 (E4184_09910) | - | 2076664..2077707 (+) | 1044 | WP_216366604.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| E4184_RS09800 (E4184_09915) | - | 2078065..2078778 (-) | 714 | WP_171276017.1 | metallophosphoesterase | - |
| E4184_RS09805 (E4184_09920) | - | 2079041..2079811 (-) | 771 | WP_171276018.1 | ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17284.34 Da Isoelectric Point: 8.4533
>NTDB_id=354328 E4184_RS09515 WP_171275975.1 2038395..2038865(-) (ssb) [Aeromonas media strain T0.1-19]
MSRGINKVILIGNLGQDPEVRYMPGGNAVTSITLATSETWRDKQTGEHKERTEWHRVVFMGKLAEVAGQHLKKGAQVYVE
GKLQTRKWRDQSGQERYTTEVLVDSFTGVLQMLGGKPQQGSSQKAQSQPPARPAATPSAGQQSNEPPFDYDDDLPF
MSRGINKVILIGNLGQDPEVRYMPGGNAVTSITLATSETWRDKQTGEHKERTEWHRVVFMGKLAEVAGQHLKKGAQVYVE
GKLQTRKWRDQSGQERYTTEVLVDSFTGVLQMLGGKPQQGSSQKAQSQPPARPAATPSAGQQSNEPPFDYDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=354328 E4184_RS09515 WP_171275975.1 2038395..2038865(-) (ssb) [Aeromonas media strain T0.1-19]
ATGAGCAGAGGCATCAACAAGGTCATCCTGATCGGCAACCTTGGCCAGGATCCGGAAGTGCGCTACATGCCAGGCGGGAA
CGCTGTCACCAGCATCACCTTGGCCACCTCCGAGACCTGGCGCGACAAGCAGACAGGGGAGCATAAGGAGCGCACCGAGT
GGCACCGGGTGGTGTTCATGGGAAAGCTGGCCGAGGTAGCCGGGCAGCACCTGAAGAAGGGGGCGCAGGTCTATGTGGAA
GGGAAGCTGCAGACCCGCAAGTGGCGGGATCAGAGCGGCCAGGAACGCTACACGACCGAGGTCCTTGTCGACAGCTTCAC
CGGGGTACTGCAGATGCTTGGCGGCAAGCCGCAGCAAGGCAGTTCGCAGAAGGCTCAGTCCCAGCCACCAGCCAGGCCTG
CCGCCACCCCATCTGCGGGCCAGCAAAGCAACGAGCCGCCATTTGATTACGATGACGACCTGCCGTTCTAG
ATGAGCAGAGGCATCAACAAGGTCATCCTGATCGGCAACCTTGGCCAGGATCCGGAAGTGCGCTACATGCCAGGCGGGAA
CGCTGTCACCAGCATCACCTTGGCCACCTCCGAGACCTGGCGCGACAAGCAGACAGGGGAGCATAAGGAGCGCACCGAGT
GGCACCGGGTGGTGTTCATGGGAAAGCTGGCCGAGGTAGCCGGGCAGCACCTGAAGAAGGGGGCGCAGGTCTATGTGGAA
GGGAAGCTGCAGACCCGCAAGTGGCGGGATCAGAGCGGCCAGGAACGCTACACGACCGAGGTCCTTGTCGACAGCTTCAC
CGGGGTACTGCAGATGCTTGGCGGCAAGCCGCAGCAAGGCAGTTCGCAGAAGGCTCAGTCCCAGCCACCAGCCAGGCCTG
CCGCCACCCCATCTGCGGGCCAGCAAAGCAACGAGCCGCCATTTGATTACGATGACGACCTGCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
60.571 |
100 |
0.679 |
| ssb | Glaesserella parasuis strain SC1401 |
47.568 |
100 |
0.564 |
| ssb | Neisseria meningitidis MC58 |
42.373 |
100 |
0.481 |
| ssb | Neisseria gonorrhoeae MS11 |
42.373 |
100 |
0.481 |