Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   EYS44_RS12050 Genome accession   NZ_CP037417
Coordinates   2508237..2508614 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain LB002     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2503237..2513614
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EYS44_RS12010 (EYS44_12005) - 2503735..2504529 (+) 795 WP_003153106.1 YqhG family protein -
  EYS44_RS12015 (EYS44_12010) sinI 2504706..2504879 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  EYS44_RS12020 (EYS44_12015) sinR 2504913..2505248 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  EYS44_RS12025 (EYS44_12020) - 2505296..2506081 (-) 786 WP_015388008.1 TasA family protein -
  EYS44_RS12030 (EYS44_12025) - 2506145..2506729 (-) 585 WP_003153100.1 signal peptidase I -
  EYS44_RS12035 (EYS44_12030) tapA 2506701..2507372 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  EYS44_RS12040 (EYS44_12035) - 2507632..2507961 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  EYS44_RS12045 (EYS44_12040) - 2508001..2508180 (-) 180 WP_003153093.1 YqzE family protein -
  EYS44_RS12050 (EYS44_12045) comGG 2508237..2508614 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  EYS44_RS12055 (EYS44_12050) comGF 2508615..2509115 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  EYS44_RS12060 (EYS44_12055) comGE 2509024..2509338 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  EYS44_RS12065 (EYS44_12060) comGD 2509322..2509759 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  EYS44_RS12070 (EYS44_12065) comGC 2509749..2510015 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  EYS44_RS12075 (EYS44_12070) comGB 2510062..2511099 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  EYS44_RS12080 (EYS44_12075) comGA 2511086..2512156 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  EYS44_RS12085 (EYS44_12080) - 2512348..2513298 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=349634 EYS44_RS12050 WP_003153092.1 2508237..2508614(-) (comGG) [Bacillus velezensis strain LB002]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=349634 EYS44_RS12050 WP_003153092.1 2508237..2508614(-) (comGG) [Bacillus velezensis strain LB002]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment