Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | EYS44_RS12015 | Genome accession | NZ_CP037417 |
| Coordinates | 2504706..2504879 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain LB002 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2499706..2509879
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EYS44_RS12000 (EYS44_11995) | gcvT | 2500521..2501621 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| EYS44_RS12005 (EYS44_12000) | - | 2502047..2503717 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| EYS44_RS12010 (EYS44_12005) | - | 2503735..2504529 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| EYS44_RS12015 (EYS44_12010) | sinI | 2504706..2504879 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| EYS44_RS12020 (EYS44_12015) | sinR | 2504913..2505248 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| EYS44_RS12025 (EYS44_12020) | - | 2505296..2506081 (-) | 786 | WP_015388008.1 | TasA family protein | - |
| EYS44_RS12030 (EYS44_12025) | - | 2506145..2506729 (-) | 585 | WP_003153100.1 | signal peptidase I | - |
| EYS44_RS12035 (EYS44_12030) | tapA | 2506701..2507372 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| EYS44_RS12040 (EYS44_12035) | - | 2507632..2507961 (+) | 330 | WP_024085599.1 | DUF3889 domain-containing protein | - |
| EYS44_RS12045 (EYS44_12040) | - | 2508001..2508180 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| EYS44_RS12050 (EYS44_12045) | comGG | 2508237..2508614 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| EYS44_RS12055 (EYS44_12050) | comGF | 2508615..2509115 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| EYS44_RS12060 (EYS44_12055) | comGE | 2509024..2509338 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| EYS44_RS12065 (EYS44_12060) | comGD | 2509322..2509759 (-) | 438 | WP_024085600.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=349632 EYS44_RS12015 WP_003153105.1 2504706..2504879(+) (sinI) [Bacillus velezensis strain LB002]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=349632 EYS44_RS12015 WP_003153105.1 2504706..2504879(+) (sinI) [Bacillus velezensis strain LB002]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |