Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   GII88_RS13980 Genome accession   NZ_CP045814
Coordinates   2664610..2665047 (-) Length   145 a.a.
NCBI ID   WP_009327905.1    Uniprot ID   Q8VQ70
Organism   Bacillus licheniformis strain P8_B2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2659610..2670047
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII88_RS13930 (GII88_13930) sinI 2659785..2659961 (+) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  GII88_RS13935 (GII88_13935) sinR 2659995..2660330 (+) 336 WP_025804940.1 helix-turn-helix domain-containing protein Regulator
  GII88_RS13940 (GII88_13940) - 2660435..2661229 (-) 795 WP_003183447.1 TasA family protein -
  GII88_RS13945 (GII88_13945) - 2661303..2661887 (-) 585 WP_003183449.1 signal peptidase I -
  GII88_RS13950 (GII88_13950) tapA 2661884..2662612 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  GII88_RS13955 (GII88_13955) - 2662922..2663209 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  GII88_RS13960 (GII88_13960) - 2663233..2663415 (-) 183 WP_003183456.1 YqzE family protein -
  GII88_RS13965 (GII88_13965) comGG 2663504..2663869 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  GII88_RS13970 (GII88_13970) comGF 2663882..2664370 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  GII88_RS13975 (GII88_13975) comGE 2664279..2664626 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  GII88_RS13980 (GII88_13980) comGD 2664610..2665047 (-) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  GII88_RS13985 (GII88_13985) comGC 2665053..2665346 (-) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  GII88_RS13990 (GII88_13990) comGB 2665360..2666394 (-) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  GII88_RS13995 (GII88_13995) comGA 2666384..2667448 (-) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  GII88_RS14000 (GII88_14000) - 2667605..2668444 (-) 840 WP_003183480.1 STAS domain-containing protein -
  GII88_RS14010 (GII88_14010) - 2668686..2669063 (-) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  GII88_RS14015 (GII88_14015) - 2669272..2669517 (+) 246 WP_003183483.1 DUF2626 domain-containing protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16249.07 Da        Isoelectric Point: 9.6739

>NTDB_id=346526 GII88_RS13980 WP_009327905.1 2664610..2665047(-) (comGD) [Bacillus licheniformis strain P8_B2]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=346526 GII88_RS13980 WP_009327905.1 2664610..2665047(-) (comGD) [Bacillus licheniformis strain P8_B2]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8VQ70

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

39.86

98.621

0.393


Multiple sequence alignment