Detailed information NTG0346526

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: GII88_RS13980
• Genome accession: NZ_CP045814
• Coordinates: 2664610..2665047 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain P8_B2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2659610..2670047

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GII88_RS13930 (GII88_13930)	sinI	2659785..2659961 (+)	177	WP_003183444.1	anti-repressor SinI family protein	Regulator
GII88_RS13935 (GII88_13935)	sinR	2659995..2660330 (+)	336	WP_025804940.1	helix-turn-helix domain-containing protein	Regulator
GII88_RS13940 (GII88_13940)	-	2660435..2661229 (-)	795	WP_003183447.1	TasA family protein	-
GII88_RS13945 (GII88_13945)	-	2661303..2661887 (-)	585	WP_003183449.1	signal peptidase I	-
GII88_RS13950 (GII88_13950)	tapA	2661884..2662612 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
GII88_RS13955 (GII88_13955)	-	2662922..2663209 (+)	288	WP_223307118.1	YqzG/YhdC family protein	-
GII88_RS13960 (GII88_13960)	-	2663233..2663415 (-)	183	WP_003183456.1	YqzE family protein	-
GII88_RS13965 (GII88_13965)	comGG	2663504..2663869 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
GII88_RS13970 (GII88_13970)	comGF	2663882..2664370 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
GII88_RS13975 (GII88_13975)	comGE	2664279..2664626 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
GII88_RS13980 (GII88_13980)	comGD	2664610..2665047 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
GII88_RS13985 (GII88_13985)	comGC	2665053..2665346 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
GII88_RS13990 (GII88_13990)	comGB	2665360..2666394 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
GII88_RS13995 (GII88_13995)	comGA	2666384..2667448 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
GII88_RS14000 (GII88_14000)	-	2667605..2668444 (-)	840	WP_003183480.1	STAS domain-containing protein	-
GII88_RS14010 (GII88_14010)	-	2668686..2669063 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
GII88_RS14015 (GII88_14015)	-	2669272..2669517 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=346526 GII88_RS13980 WP_009327905.1 2664610..2665047(-) (comGD) [Bacillus licheniformis strain P8_B2]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=346526 GII88_RS13980 WP_009327905.1 2664610..2665047(-) (comGD) [Bacillus licheniformis strain P8_B2]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393