Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII88_RS13930 Genome accession   NZ_CP045814
Coordinates   2659785..2659961 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   Q65HF5
Organism   Bacillus licheniformis strain P8_B2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2654785..2664961
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII88_RS13915 (GII88_13915) gcvT 2655427..2656521 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  GII88_RS13920 (GII88_13920) - 2657114..2658793 (+) 1680 WP_003183439.1 SNF2-related protein -
  GII88_RS13925 (GII88_13925) - 2658800..2659594 (+) 795 WP_003183441.1 YqhG family protein -
  GII88_RS13930 (GII88_13930) sinI 2659785..2659961 (+) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  GII88_RS13935 (GII88_13935) sinR 2659995..2660330 (+) 336 WP_025804940.1 helix-turn-helix domain-containing protein Regulator
  GII88_RS13940 (GII88_13940) - 2660435..2661229 (-) 795 WP_003183447.1 TasA family protein -
  GII88_RS13945 (GII88_13945) - 2661303..2661887 (-) 585 WP_003183449.1 signal peptidase I -
  GII88_RS13950 (GII88_13950) tapA 2661884..2662612 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  GII88_RS13955 (GII88_13955) - 2662922..2663209 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  GII88_RS13960 (GII88_13960) - 2663233..2663415 (-) 183 WP_003183456.1 YqzE family protein -
  GII88_RS13965 (GII88_13965) comGG 2663504..2663869 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  GII88_RS13970 (GII88_13970) comGF 2663882..2664370 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  GII88_RS13975 (GII88_13975) comGE 2664279..2664626 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=346524 GII88_RS13930 WP_003183444.1 2659785..2659961(+) (sinI) [Bacillus licheniformis strain P8_B2]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=346524 GII88_RS13930 WP_003183444.1 2659785..2659961(+) (sinI) [Bacillus licheniformis strain P8_B2]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q65HF5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517


Multiple sequence alignment