Detailed information NTG0345043

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: Len3610_RS07225
• Genome accession: NZ_CP035925
• Coordinates: 1426687..1427112 (-)
• Length: 141 a.a.
• NCBI ID: WP_176447346.1
• Uniprot ID: -
• Organism: Lentibacillus sp. CBA3610
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1424129..1435970	1426687..1427112	within	0

Gene organization within MGE regions

Location: 1424129..1435970

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
Len3610_RS07205 (Len3610_07220)	-	1424129..1424446 (-)	318	WP_176447342.1	helix-turn-helix transcriptional regulator	-
Len3610_RS07210 (Len3610_07225)	-	1424615..1425229 (-)	615	WP_176447343.1	DUF6241 domain-containing protein	-
Len3610_RS07215 (Len3610_07230)	-	1425383..1425673 (-)	291	WP_176447344.1	hypothetical protein	-
Len3610_RS07220 (Len3610_07235)	-	1425894..1426607 (-)	714	WP_176447345.1	PD-(D/E)XK nuclease family protein	-
Len3610_RS07225 (Len3610_07240)	ssbA	1426687..1427112 (-)	426	WP_176447346.1	single-stranded DNA-binding protein	Machinery gene
Len3610_RS07230 (Len3610_07245)	-	1427129..1427737 (-)	609	WP_176447347.1	hypothetical protein	-
Len3610_RS07235 (Len3610_07250)	-	1427935..1429203 (-)	1269	WP_176447348.1	RecT family recombinase	-
Len3610_RS07240 (Len3610_07255)	-	1429851..1429973 (+)	123	WP_176447349.1	FbpB family small basic protein	-
Len3610_RS21760	-	1430195..1430275 (-)	81	WP_369693685.1	putative holin-like toxin	-
Len3610_RS07245 (Len3610_07260)	sda	1430419..1430565 (-)	147	WP_176447350.1	sporulation histidine kinase inhibitor Sda	-
Len3610_RS07250 (Len3610_07265)	-	1430655..1431353 (-)	699	WP_176447351.1	hypothetical protein	-
Len3610_RS07255 (Len3610_07270)	-	1431367..1432212 (-)	846	WP_176447352.1	S1 RNA-binding domain-containing protein	-
Len3610_RS07260 (Len3610_07275)	-	1432312..1434513 (-)	2202	WP_255259830.1	type IV secretory system conjugative DNA transfer family protein	-
Len3610_RS07265 (Len3610_07280)	-	1434649..1434876 (-)	228	WP_176447353.1	hypothetical protein	-
Len3610_RS07270 (Len3610_07285)	-	1434873..1435970 (-)	1098	WP_176447354.1	replication-relaxation family protein	-

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 15897.49 Da
• Isoelectric Point: 6.9510

>NTDB_id=345043 Len3610_RS07225 WP_176447346.1 1426687..1427112(-) (ssbA) [Lentibacillus sp. CBA3610]
MNNVQLIGRMTKDVELKYTQNGNAVATFTLAVNRPFRNHQGNQDADFIRCQVWRKPAENTAQYCKRGSQVGVTGRIQTRS
FEGQDGKTVFMTEVVADNVEFLDTRNQSSQGKPQNNQNQQSNNPYQGQGVPVDVNDEDLPF

Nucleotide

• Length: 426 bp

>NTDB_id=345043 Len3610_RS07225 WP_176447346.1 1426687..1427112(-) (ssbA) [Lentibacillus sp. CBA3610]
ATGAACAATGTCCAATTAATCGGGCGCATGACAAAAGATGTGGAGCTGAAATACACACAAAACGGCAATGCCGTGGCAAC
TTTTACGCTGGCGGTCAACCGTCCTTTTAGAAATCATCAGGGCAATCAGGATGCGGATTTCATTCGTTGTCAGGTGTGGC
GCAAACCTGCCGAGAACACAGCACAATACTGTAAGAGAGGTTCTCAGGTAGGTGTCACAGGCCGTATCCAGACGCGCTCT
TTTGAGGGGCAGGATGGCAAAACCGTATTTATGACGGAAGTCGTCGCCGATAACGTCGAATTTCTTGATACACGCAATCA
AAGCAGTCAGGGAAAACCACAAAACAACCAAAATCAGCAATCGAATAATCCGTATCAGGGCCAGGGCGTACCGGTTGATG
TCAACGATGAGGATTTGCCGTTTTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (1-102)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	45.029	100	0.546
ssb	Latilactobacillus sakei subsp. sakei 23K	43.195	100	0.518
ssbB	Bacillus subtilis subsp. subtilis str. 168	58.252	73.05	0.426
ssb	Glaesserella parasuis strain SC1401	28.814	100	0.362