Detailed information
Bioinformatically predicted
Overview
| Name | comEA | Type | Machinery gene |
| Locus tag | ETL58_RS13115 | Genome accession | NZ_CP035413 |
| Coordinates | 2525167..2525784 (-) | Length | 205 a.a. |
| NCBI ID | WP_029317886.1 | Uniprot ID | - |
| Organism | Bacillus subtilis strain SRCM103629 | ||
| Function | dsDNA binding to the cell surface (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2522197..2587025 | 2525167..2525784 | within | 0 |
Gene organization within MGE regions
Location: 2522197..2587025
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETL58_RS13105 (ETL58_13105) | comEC | 2522197..2524527 (-) | 2331 | WP_101172381.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
| ETL58_RS13110 (ETL58_13110) | comEB | 2524531..2525100 (-) | 570 | WP_003229978.1 | ComE operon protein 2 | - |
| ETL58_RS13115 (ETL58_13115) | comEA | 2525167..2525784 (-) | 618 | WP_029317886.1 | competence protein ComEA | Machinery gene |
| ETL58_RS13120 (ETL58_13120) | comER | 2525868..2526689 (+) | 822 | WP_014480313.1 | late competence protein ComER | - |
| ETL58_RS13125 (ETL58_13125) | yqeM | 2526755..2527498 (-) | 744 | WP_029317885.1 | class I SAM-dependent methyltransferase | - |
| ETL58_RS13130 (ETL58_13130) | rsfS | 2527495..2527851 (-) | 357 | WP_014480315.1 | ribosome silencing factor | - |
| ETL58_RS13135 (ETL58_13135) | yqeK | 2527869..2528429 (-) | 561 | WP_029317884.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| ETL58_RS13140 (ETL58_13140) | nadD | 2528419..2528988 (-) | 570 | WP_004398676.1 | nicotinate-nucleotide adenylyltransferase | - |
| ETL58_RS13145 (ETL58_13145) | yhbY | 2529000..2529290 (-) | 291 | WP_003226133.1 | ribosome assembly RNA-binding protein YhbY | - |
| ETL58_RS13150 (ETL58_13150) | aroE | 2529284..2530126 (-) | 843 | WP_101172380.1 | shikimate dehydrogenase | - |
| ETL58_RS13155 (ETL58_13155) | yqeH | 2530144..2531244 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| ETL58_RS13160 (ETL58_13160) | yqeG | 2531248..2531766 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| ETL58_RS13165 (ETL58_13165) | - | 2532128..2532268 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| ETL58_RS13170 (ETL58_13170) | yqeF | 2532574..2533305 (-) | 732 | WP_101172379.1 | SGNH/GDSL hydrolase family protein | - |
| ETL58_RS13175 (ETL58_13175) | cwlH | 2533557..2534309 (-) | 753 | WP_029726701.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| ETL58_RS13180 (ETL58_13180) | yqeD | 2534496..2535122 (+) | 627 | WP_101172378.1 | TVP38/TMEM64 family protein | - |
| ETL58_RS13185 (ETL58_13185) | gnd | 2535141..2536034 (-) | 894 | WP_101172377.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| ETL58_RS13190 (ETL58_13190) | yqeB | 2536286..2537008 (+) | 723 | WP_010886572.1 | hypothetical protein | - |
| ETL58_RS13195 (ETL58_13195) | nucA/comI | 2537041..2537451 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| ETL58_RS13200 (ETL58_13200) | - | 2537647..2537994 (+) | 348 | Protein_2548 | sigma-70 family RNA polymerase sigma factor | - |
| ETL58_RS13205 (ETL58_13205) | spoIVCA | 2538025..2539485 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| ETL58_RS21785 (ETL58_13210) | - | 2539443..2539621 (-) | 179 | Protein_2550 | hypothetical protein | - |
| ETL58_RS13215 (ETL58_13215) | arsC | 2539976..2540395 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| ETL58_RS13220 (ETL58_13220) | acr3 | 2540407..2541447 (-) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| ETL58_RS13225 (ETL58_13225) | arsK | 2541470..2541910 (-) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| ETL58_RS13230 (ETL58_13230) | arsR | 2541971..2542288 (-) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| ETL58_RS13235 (ETL58_13235) | yqcI | 2542660..2543424 (-) | 765 | WP_017696291.1 | YqcI/YcgG family protein | - |
| ETL58_RS13240 (ETL58_13240) | rapE | 2543867..2544994 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| ETL58_RS13245 (ETL58_13245) | phrE | 2544984..2545118 (+) | 135 | WP_014114495.1 | phosphatase RapE inhibitor PhrE | - |
| ETL58_RS13250 (ETL58_13250) | - | 2545228..2545387 (+) | 160 | Protein_2558 | hypothetical protein | - |
| ETL58_RS13255 (ETL58_13255) | - | 2545756..2547609 (+) | 1854 | WP_017696293.1 | T7SS effector LXG polymorphic toxin | - |
| ETL58_RS13260 (ETL58_13260) | - | 2547621..2548073 (+) | 453 | WP_017696294.1 | SMI1/KNR4 family protein | - |
| ETL58_RS13265 (ETL58_13265) | cdiI | 2548170..2548529 (+) | 360 | WP_017696295.1 | ribonuclease toxin immunity protein CdiI | - |
| ETL58_RS13270 (ETL58_13270) | yqcF | 2548878..2549456 (+) | 579 | WP_017697458.1 | type VII secretion system immunity protein YqcF | - |
| ETL58_RS13275 (ETL58_13275) | - | 2549574..2549720 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| ETL58_RS13280 (ETL58_13280) | - | 2549717..2550079 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| ETL58_RS13285 (ETL58_13285) | - | 2550095..2550574 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| ETL58_RS13290 (ETL58_13290) | cwlA | 2550739..2551557 (-) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| ETL58_RS13295 (ETL58_13295) | skhD | 2551601..2552023 (-) | 423 | WP_017697460.1 | holin family protein | - |
| ETL58_RS13300 (ETL58_13300) | xepAK | 2552069..2552962 (-) | 894 | WP_032722160.1 | hypothetical protein | - |
| ETL58_RS13305 (ETL58_13305) | yqcE | 2553050..2553214 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| ETL58_RS13310 (ETL58_13310) | yqcD | 2553211..2553546 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| ETL58_RS13315 (ETL58_13315) | yqcC | 2553556..2554656 (-) | 1101 | WP_032722161.1 | pyocin knob domain-containing protein | - |
| ETL58_RS13320 (ETL58_13320) | - | 2554660..2554932 (-) | 273 | WP_032722163.1 | hypothetical protein | - |
| ETL58_RS13325 (ETL58_13325) | yqcA | 2554929..2555507 (-) | 579 | WP_032722164.1 | YmfQ family protein | - |
| ETL58_RS13330 (ETL58_13330) | yqbT | 2555491..2556537 (-) | 1047 | WP_032722165.1 | baseplate J/gp47 family protein | - |
| ETL58_RS13335 (ETL58_13335) | yqbS | 2556530..2556955 (-) | 426 | WP_032722166.1 | DUF2634 domain-containing protein | - |
| ETL58_RS13340 (ETL58_13340) | yqbR | 2556968..2557234 (-) | 267 | WP_032722167.1 | DUF2577 family protein | - |
| ETL58_RS13345 (ETL58_13345) | yqbQ | 2557231..2558211 (-) | 981 | WP_032722168.1 | hypothetical protein | - |
| ETL58_RS13350 (ETL58_13350) | yqbP | 2558224..2558883 (-) | 660 | WP_032722169.1 | LysM peptidoglycan-binding domain-containing protein | - |
| ETL58_RS13355 (ETL58_13355) | yqbO | 2558876..2563633 (-) | 4758 | WP_043940167.1 | phage tail tape measure protein | - |
| ETL58_RS13360 (ETL58_13360) | - | 2563636..2563773 (-) | 138 | WP_021480099.1 | hypothetical protein | - |
| ETL58_RS13365 (ETL58_13365) | - | 2563815..2564264 (-) | 450 | WP_032722171.1 | phage portal protein | - |
| ETL58_RS13370 (ETL58_13370) | txpA | 2564410..2564589 (+) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| ETL58_RS13375 (ETL58_13375) | bsrH | 2564969..2565058 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| ETL58_RS13380 (ETL58_13380) | yqbM | 2565312..2565755 (-) | 444 | WP_003229930.1 | phage tail tube protein | - |
| ETL58_RS13385 (ETL58_13385) | yqbK | 2565758..2567158 (-) | 1401 | WP_129010212.1 | phage tail sheath family protein | - |
| ETL58_RS13390 (ETL58_13390) | - | 2567159..2567350 (-) | 192 | WP_033880532.1 | hypothetical protein | - |
| ETL58_RS13395 (ETL58_13395) | yqbJ | 2567347..2567784 (-) | 438 | WP_017697472.1 | DUF6838 family protein | - |
| ETL58_RS13400 (ETL58_13400) | yqbI | 2567797..2568300 (-) | 504 | WP_017697473.1 | HK97 gp10 family phage protein | - |
| ETL58_RS13405 (ETL58_13405) | yqbH | 2568297..2568659 (-) | 363 | WP_129010213.1 | YqbH/XkdH family protein | - |
| ETL58_RS13410 (ETL58_13410) | gkpG | 2568656..2569051 (-) | 396 | WP_015714318.1 | DUF3199 family protein | - |
| ETL58_RS13415 (ETL58_13415) | yqbF | 2569056..2569367 (-) | 312 | WP_015714319.1 | YqbF domain-containing protein | - |
| ETL58_RS13420 (ETL58_13420) | skdG | 2569378..2570313 (-) | 936 | WP_015714320.1 | phage major capsid protein | - |
| ETL58_RS13425 (ETL58_13425) | yqbD | 2570332..2571306 (-) | 975 | WP_015714321.1 | XkdF-like putative serine protease domain-containing protein | - |
| ETL58_RS13430 (ETL58_13430) | - | 2571463..2572368 (-) | 906 | WP_040082428.1 | hypothetical protein | - |
| ETL58_RS13435 (ETL58_13435) | - | 2572413..2573330 (-) | 918 | WP_068947618.1 | phage head morphogenesis protein | - |
| ETL58_RS13440 (ETL58_13440) | yqbA | 2573327..2574859 (-) | 1533 | WP_068947619.1 | phage portal protein | - |
| ETL58_RS13445 (ETL58_13445) | stmB | 2574863..2576158 (-) | 1296 | WP_072692701.1 | PBSX family phage terminase large subunit | - |
| ETL58_RS13450 (ETL58_13450) | terS | 2576151..2576870 (-) | 720 | WP_017697483.1 | phage terminase small subunit | - |
| ETL58_RS13455 (ETL58_13455) | - | 2576946..2577704 (-) | 759 | WP_068947621.1 | DNA-directed RNA polymerase | - |
| ETL58_RS13460 (ETL58_13460) | - | 2577820..2578287 (-) | 468 | WP_017697601.1 | hypothetical protein | - |
| ETL58_RS13465 (ETL58_13465) | yqaQ | 2578431..2578886 (-) | 456 | WP_017697600.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| ETL58_RS13470 (ETL58_13470) | - | 2578977..2579735 (-) | 759 | WP_017697599.1 | hypothetical protein | - |
| ETL58_RS13475 (ETL58_13475) | - | 2579945..2580304 (+) | 360 | WP_017697598.1 | hypothetical protein | - |
| ETL58_RS13480 (ETL58_13480) | yqaO | 2580452..2580661 (-) | 210 | WP_017697597.1 | XtrA/YqaO family protein | - |
| ETL58_RS13485 (ETL58_13485) | yqaN | 2580743..2581171 (-) | 429 | WP_017697596.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ETL58_RS13490 (ETL58_13490) | - | 2581266..2581415 (-) | 150 | WP_072692702.1 | hypothetical protein | - |
| ETL58_RS13495 (ETL58_13495) | sknM | 2581406..2582347 (-) | 942 | WP_072692704.1 | ATP-binding protein | - |
| ETL58_RS13500 (ETL58_13500) | yqaL | 2582229..2582906 (-) | 678 | WP_128992198.1 | DnaD domain protein | - |
| ETL58_RS13505 (ETL58_13505) | recT | 2582983..2583837 (-) | 855 | WP_017697591.1 | recombinase RecT | - |
| ETL58_RS13510 (ETL58_13510) | yqaJ | 2583840..2584799 (-) | 960 | WP_068947622.1 | YqaJ viral recombinase family protein | - |
| ETL58_RS13515 (ETL58_13515) | - | 2584905..2585099 (-) | 195 | WP_068947623.1 | hypothetical protein | - |
| ETL58_RS13520 (ETL58_13520) | - | 2585059..2585232 (-) | 174 | WP_122060486.1 | hypothetical protein | - |
| ETL58_RS13525 (ETL58_13525) | sknH | 2585229..2585486 (-) | 258 | WP_015714340.1 | YqaH family protein | - |
| ETL58_RS13530 (ETL58_13530) | yqaG | 2585483..2586052 (-) | 570 | WP_068947624.1 | helix-turn-helix transcriptional regulator | - |
| ETL58_RS13535 (ETL58_13535) | - | 2586126..2586266 (-) | 141 | WP_129010214.1 | hypothetical protein | - |
| ETL58_RS13540 (ETL58_13540) | - | 2586296..2586517 (-) | 222 | WP_129010215.1 | helix-turn-helix transcriptional regulator | - |
| ETL58_RS13545 (ETL58_13545) | - | 2586666..2587025 (+) | 360 | WP_129010216.1 | helix-turn-helix transcriptional regulator | - |
Sequence
Protein
Download Length: 205 a.a. Molecular weight: 21722.44 Da Isoelectric Point: 4.7220
>NTDB_id=340808 ETL58_RS13115 WP_029317886.1 2525167..2525784(-) (comEA) [Bacillus subtilis strain SRCM103629]
MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETENTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRT
GDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGAVQSDGGKGALVNINTATLEELQGISGV
GPSKAEAIIAYREENGRFPTIEDITKVSGIGEKSFEKIKSSITVK
MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETENTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRT
GDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGAVQSDGGKGALVNINTATLEELQGISGV
GPSKAEAIIAYREENGRFPTIEDITKVSGIGEKSFEKIKSSITVK
Nucleotide
Download Length: 618 bp
>NTDB_id=340808 ETL58_RS13115 WP_029317886.1 2525167..2525784(-) (comEA) [Bacillus subtilis strain SRCM103629]
ATGAATTGGTTGAATCAGCATAAGAAAGCAATTATTTTAGCGGCTTCTGCGGCTGTTTTCACAGCGATTATGATCTTTCT
GGCCACAGGGAAAAATAAAGAGCCGGTGAAGCAAGCTGTACCAACAGAGACAGAAAATACAGTGGTAAAGCAGGAAGCAA
ACAACGACGAGTCAAACGAAACAATTGTGATAGACATCAAAGGTGCTGTTCAGCATCCTGGCGTTTATGAAATGCGAACA
GGGGACAGAGTATCTCAGGCAATTGAGAAAGCGGGCGGGACCAGTGAACAAGCAGACGAAGCGCAAGTAAATTTGGCGGA
GATTCTGCAGGACGGGACAGTGGTGTACATCCCGAAAAAGGGAGAGGAAACAGCAGTGCAGCAAGGTGGCGGAGGGGCTG
TCCAAAGCGATGGAGGGAAGGGAGCGCTGGTGAATATCAATACAGCAACCTTAGAGGAGTTACAAGGCATCTCAGGGGTG
GGGCCATCCAAAGCTGAAGCTATTATTGCATACCGGGAAGAAAACGGGCGTTTCCCAACAATTGAAGATATCACTAAGGT
TTCAGGAATAGGTGAAAAGTCATTTGAGAAAATAAAGTCTTCCATTACAGTAAAGTGA
ATGAATTGGTTGAATCAGCATAAGAAAGCAATTATTTTAGCGGCTTCTGCGGCTGTTTTCACAGCGATTATGATCTTTCT
GGCCACAGGGAAAAATAAAGAGCCGGTGAAGCAAGCTGTACCAACAGAGACAGAAAATACAGTGGTAAAGCAGGAAGCAA
ACAACGACGAGTCAAACGAAACAATTGTGATAGACATCAAAGGTGCTGTTCAGCATCCTGGCGTTTATGAAATGCGAACA
GGGGACAGAGTATCTCAGGCAATTGAGAAAGCGGGCGGGACCAGTGAACAAGCAGACGAAGCGCAAGTAAATTTGGCGGA
GATTCTGCAGGACGGGACAGTGGTGTACATCCCGAAAAAGGGAGAGGAAACAGCAGTGCAGCAAGGTGGCGGAGGGGCTG
TCCAAAGCGATGGAGGGAAGGGAGCGCTGGTGAATATCAATACAGCAACCTTAGAGGAGTTACAAGGCATCTCAGGGGTG
GGGCCATCCAAAGCTGAAGCTATTATTGCATACCGGGAAGAAAACGGGCGTTTCCCAACAATTGAAGATATCACTAAGGT
TTCAGGAATAGGTGAAAAGTCATTTGAGAAAATAAAGTCTTCCATTACAGTAAAGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comEA | Bacillus subtilis subsp. subtilis str. 168 |
99.024 |
100 |
0.99 |
| comEA | Staphylococcus aureus MW2 |
36.364 |
100 |
0.39 |
| comEA | Staphylococcus aureus N315 |
35.455 |
100 |
0.38 |