Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ETL58_RS12600 Genome accession   NZ_CP035413
Coordinates   2438130..2438303 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM103629     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2433130..2443303
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETL58_RS12585 (ETL58_12585) gcvT 2433929..2435017 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  ETL58_RS12590 (ETL58_12590) hepAA 2435459..2437132 (+) 1674 WP_004398544.1 SNF2-related protein -
  ETL58_RS12595 (ETL58_12595) yqhG 2437153..2437947 (+) 795 WP_003230200.1 YqhG family protein -
  ETL58_RS12600 (ETL58_12600) sinI 2438130..2438303 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETL58_RS12605 (ETL58_12605) sinR 2438337..2438672 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETL58_RS12610 (ETL58_12610) tasA 2438765..2439550 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  ETL58_RS12615 (ETL58_12615) sipW 2439614..2440186 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ETL58_RS12620 (ETL58_12620) tapA 2440170..2440931 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  ETL58_RS12625 (ETL58_12625) yqzG 2441203..2441529 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ETL58_RS12630 (ETL58_12630) spoIITA 2441571..2441750 (-) 180 WP_003230176.1 YqzE family protein -
  ETL58_RS12635 (ETL58_12635) comGG 2441821..2442195 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  ETL58_RS12640 (ETL58_12640) comGF 2442196..2442579 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  ETL58_RS12645 (ETL58_12645) comGE 2442605..2442952 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=340796 ETL58_RS12600 WP_003230187.1 2438130..2438303(+) (sinI) [Bacillus subtilis strain SRCM103629]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=340796 ETL58_RS12600 WP_003230187.1 2438130..2438303(+) (sinI) [Bacillus subtilis strain SRCM103629]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment