Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ES969_RS12940 Genome accession   NZ_CP035402
Coordinates   2380215..2380589 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain SRCM103576     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2375215..2385589
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES969_RS12900 (ES969_12900) yqhG 2375545..2376339 (+) 795 WP_014480249.1 YqhG family protein -
  ES969_RS12905 (ES969_12905) sinI 2376522..2376695 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES969_RS12910 (ES969_12910) sinR 2376729..2377064 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES969_RS12915 (ES969_12915) tasA 2377157..2377942 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ES969_RS12920 (ES969_12920) sipW 2378007..2378579 (-) 573 WP_129134142.1 signal peptidase I SipW -
  ES969_RS12925 (ES969_12925) tapA 2378563..2379324 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ES969_RS12930 (ES969_12930) yqzG 2379596..2379922 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ES969_RS12935 (ES969_12935) spoIITA 2379964..2380143 (-) 180 WP_029726723.1 YqzE family protein -
  ES969_RS12940 (ES969_12940) comGG 2380215..2380589 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ES969_RS12945 (ES969_12945) comGF 2380590..2380973 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  ES969_RS12950 (ES969_12950) comGE 2380999..2381346 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene
  ES969_RS12955 (ES969_12955) comGD 2381330..2381761 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  ES969_RS12960 (ES969_12960) comGC 2381751..2382047 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ES969_RS12965 (ES969_12965) comGB 2382061..2383098 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  ES969_RS12970 (ES969_12970) comGA 2383085..2384155 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ES969_RS12975 (ES969_12975) - 2384367..2384564 (-) 198 WP_046160584.1 CBS domain-containing protein -
  ES969_RS12980 (ES969_12980) corA 2384566..2385519 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=340259 ES969_RS12940 WP_014480253.1 2380215..2380589(-) (comGG) [Bacillus subtilis strain SRCM103576]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=340259 ES969_RS12940 WP_014480253.1 2380215..2380589(-) (comGG) [Bacillus subtilis strain SRCM103576]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment