Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ES969_RS12905 Genome accession   NZ_CP035402
Coordinates   2376522..2376695 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM103576     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2371522..2381695
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES969_RS12890 (ES969_12890) gcvT 2372321..2373409 (-) 1089 WP_129134000.1 glycine cleavage system aminomethyltransferase GcvT -
  ES969_RS12895 (ES969_12895) hepAA 2373851..2375524 (+) 1674 WP_014480248.1 SNF2-related protein -
  ES969_RS12900 (ES969_12900) yqhG 2375545..2376339 (+) 795 WP_014480249.1 YqhG family protein -
  ES969_RS12905 (ES969_12905) sinI 2376522..2376695 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES969_RS12910 (ES969_12910) sinR 2376729..2377064 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES969_RS12915 (ES969_12915) tasA 2377157..2377942 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ES969_RS12920 (ES969_12920) sipW 2378007..2378579 (-) 573 WP_129134142.1 signal peptidase I SipW -
  ES969_RS12925 (ES969_12925) tapA 2378563..2379324 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ES969_RS12930 (ES969_12930) yqzG 2379596..2379922 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ES969_RS12935 (ES969_12935) spoIITA 2379964..2380143 (-) 180 WP_029726723.1 YqzE family protein -
  ES969_RS12940 (ES969_12940) comGG 2380215..2380589 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ES969_RS12945 (ES969_12945) comGF 2380590..2380973 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  ES969_RS12950 (ES969_12950) comGE 2380999..2381346 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=340257 ES969_RS12905 WP_003230187.1 2376522..2376695(+) (sinI) [Bacillus subtilis strain SRCM103576]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=340257 ES969_RS12905 WP_003230187.1 2376522..2376695(+) (sinI) [Bacillus subtilis strain SRCM103576]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment