Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ETA10_RS21705 Genome accession   NZ_CP035397
Coordinates   4035824..4036342 (-) Length   172 a.a.
NCBI ID   WP_003219228.1    Uniprot ID   A0A063XE16
Organism   Bacillus subtilis strain SRCM103773     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3989261..4035809 4035824..4036342 flank 15


Gene organization within MGE regions


Location: 3989261..4036342
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA10_RS21410 (ETA10_21410) yybO 3989677..3990987 (+) 1311 WP_087614837.1 MFS transporter -
  ETA10_RS21415 (ETA10_21415) - 3991147..3991884 (+) 738 WP_032676932.1 MerR family transcriptional regulator -
  ETA10_RS21420 (ETA10_21420) - 3991922..3992710 (-) 789 WP_014481489.1 hypothetical protein -
  ETA10_RS21425 (ETA10_21425) yybH 3992778..3993167 (-) 390 WP_017695798.1 nuclear transport factor 2 family protein -
  ETA10_RS21430 (ETA10_21430) yybG 3993313..3994152 (+) 840 WP_087614838.1 pentapeptide repeat-containing protein -
  ETA10_RS21435 (ETA10_21435) yybF 3994187..3995401 (-) 1215 WP_087614839.1 MFS transporter -
  ETA10_RS21440 (ETA10_21440) yybE 3995588..3996466 (+) 879 WP_044052403.1 LysR family transcriptional regulator -
  ETA10_RS21445 (ETA10_21445) yybD 3996480..3996923 (+) 444 WP_003226881.1 GNAT family N-acetyltransferase -
  ETA10_RS21450 (ETA10_21450) yybC 3997006..3997485 (+) 480 WP_087614840.1 DUF2798 domain-containing protein -
  ETA10_RS21460 (ETA10_21460) yybB 3997658..3998320 (-) 663 WP_087614841.1 MBL fold metallo-hydrolase -
  ETA10_RS21465 (ETA10_21465) yybA 3998467..3998919 (-) 453 WP_003226875.1 MarR family transcriptional regulator -
  ETA10_RS21470 (ETA10_21470) yyaT 3999039..3999485 (+) 447 WP_003226873.1 GNAT family N-acetyltransferase -
  ETA10_RS21475 (ETA10_21475) yyaS 3999482..4000084 (+) 603 WP_003226872.1 YitT family protein -
  ETA10_RS21480 (ETA10_21480) satA 4000152..4000673 (-) 522 WP_003226870.1 streptothricin N-acetyltransferase SatA -
  ETA10_RS21485 (ETA10_21485) yyaQ 4001082..4001438 (+) 357 WP_046161080.1 MmcQ/YjbR family DNA-binding protein -
  ETA10_RS21490 (ETA10_21490) yyaP 4001598..4002164 (+) 567 WP_046161081.1 dihydrofolate reductase family protein -
  ETA10_RS21495 (ETA10_21495) - 4002406..4002567 (+) 162 WP_129110614.1 DUF255 domain-containing protein -
  ETA10_RS21500 (ETA10_21500) tet(L) 4002670..4004046 (-) 1377 WP_128738555.1 tetracycline efflux MFS transporter Tet(L) -
  ETA10_RS22820 tetL 4004080..4004142 (-) 63 WP_010886645.1 tetracycline resistance efflux system leader peptide -
  ETA10_RS21510 (ETA10_21510) - 4004395..4004565 (+) 171 Protein_4161 DUF255 domain-containing protein -
  ETA10_RS21515 (ETA10_21515) - 4004642..4005061 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  ETA10_RS21520 (ETA10_21520) acr3 4005073..4006113 (-) 1041 WP_119900017.1 arsenite efflux transporter Acr3 -
  ETA10_RS21525 (ETA10_21525) - 4006135..4006575 (-) 441 WP_119900019.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  ETA10_RS21530 (ETA10_21530) arsR 4006635..4006952 (-) 318 WP_029318103.1 arsenical resistance operon transcriptional regulator ArsR -
  ETA10_RS21535 (ETA10_21535) - 4007227..4008735 (+) 1509 WP_119900021.1 recombinase family protein -
  ETA10_RS21540 (ETA10_21540) - 4008835..4009617 (-) 783 WP_119900023.1 hypothetical protein -
  ETA10_RS21545 (ETA10_21545) - 4009719..4010111 (-) 393 WP_205590911.1 cystatin-like fold lipoprotein -
  ETA10_RS21550 (ETA10_21550) - 4010165..4010671 (-) 507 WP_119900027.1 hypothetical protein -
  ETA10_RS21555 (ETA10_21555) - 4010686..4011675 (-) 990 WP_119900029.1 bifunctional lytic transglycosylase/C40 family peptidase -
  ETA10_RS21560 (ETA10_21560) - 4011672..4014119 (-) 2448 WP_119900031.1 CD3337/EF1877 family mobilome membrane protein -
  ETA10_RS21565 (ETA10_21565) yddF 4014123..4014449 (-) 327 WP_019716380.1 YddF family protein -
  ETA10_RS21570 (ETA10_21570) conE 4014467..4016962 (-) 2496 WP_119900033.1 VirB4-like ATPase ConE -
  ETA10_RS21575 (ETA10_21575) conD 4016850..4017374 (-) 525 WP_119900035.1 conjugal transfer protein -
  ETA10_RS21580 (ETA10_21580) - 4017387..4017635 (-) 249 WP_119900037.1 hypothetical protein -
  ETA10_RS21585 (ETA10_21585) conB 4017647..4018711 (-) 1065 WP_119900038.1 conjugal transfer protein -
  ETA10_RS22375 - 4018729..4018887 (-) 159 WP_162920081.1 hypothetical protein -
  ETA10_RS21590 (ETA10_21590) - 4018905..4019183 (-) 279 WP_044430163.1 hypothetical protein -
  ETA10_RS21595 (ETA10_21595) - 4019200..4019466 (-) 267 WP_119900040.1 hypothetical protein -
  ETA10_RS21600 (ETA10_21600) nicK 4019733..4020791 (-) 1059 WP_119900042.1 DNA relaxase NicK -
  ETA10_RS21605 (ETA10_21605) - 4020784..4022235 (-) 1452 WP_119900044.1 DNA translocase FtsK -
  ETA10_RS21610 (ETA10_21610) helP 4022271..4022651 (-) 381 WP_119900046.1 helicase processivity factor HelP -
  ETA10_RS21615 (ETA10_21615) - 4022668..4022814 (-) 147 WP_119900048.1 hypothetical protein -
  ETA10_RS21620 (ETA10_21620) - 4023019..4023279 (-) 261 WP_119900050.1 hypothetical protein -
  ETA10_RS21625 (ETA10_21625) - 4023332..4023592 (-) 261 WP_119900052.1 hypothetical protein -
  ETA10_RS21630 (ETA10_21630) - 4023589..4023768 (-) 180 WP_119900054.1 ICEBs1 excisionase -
  ETA10_RS21635 (ETA10_21635) - 4024065..4024448 (+) 384 WP_019716391.1 helix-turn-helix transcriptional regulator -
  ETA10_RS21640 (ETA10_21640) - 4024445..4024975 (+) 531 WP_019716392.1 ImmA/IrrE family metallo-endopeptidase -
  ETA10_RS21645 (ETA10_21645) - 4025088..4026284 (-) 1197 WP_129110617.1 Rap family tetratricopeptide repeat protein -
  ETA10_RS21650 (ETA10_21650) - 4026503..4027270 (+) 768 WP_119900058.1 hypothetical protein -
  ETA10_RS21655 (ETA10_21655) - 4027287..4028111 (+) 825 WP_119900060.1 hypothetical protein -
  ETA10_RS21665 (ETA10_21665) yyaL 4028116..4030205 (+) 2090 Protein_4192 thioredoxin domain-containing protein -
  ETA10_RS21670 (ETA10_21670) yyaK 4030202..4031101 (-) 900 WP_032724963.1 type II CAAX endopeptidase family protein -
  ETA10_RS21675 (ETA10_21675) yyaJ 4031328..4032683 (+) 1356 WP_015250786.1 MFS transporter -
  ETA10_RS21680 (ETA10_21680) maa 4032717..4033271 (-) 555 WP_046161083.1 sugar O-acetyltransferase -
  ETA10_RS21685 (ETA10_21685) yyaH 4033289..4033669 (-) 381 WP_003244460.1 VOC family protein -
  ETA10_RS21690 (ETA10_21690) ccpB 4033725..4034660 (-) 936 WP_046161084.1 transcriptional regulator CcpB -
  ETA10_RS21695 (ETA10_21695) xth 4034719..4035477 (-) 759 WP_015250782.1 exodeoxyribonuclease III -
  ETA10_RS21700 (ETA10_21700) rpsR 4035541..4035780 (-) 240 WP_003219224.1 30S ribosomal protein S18 -
  ETA10_RS21705 (ETA10_21705) ssbA 4035824..4036342 (-) 519 WP_003219228.1 single-stranded DNA-binding protein SsbA Machinery gene

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 18742.31 Da        Isoelectric Point: 4.7621

>NTDB_id=339979 ETA10_RS21705 WP_003219228.1 4035824..4036342(-) (ssbA) [Bacillus subtilis strain SRCM103773]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=339979 ETA10_RS21705 WP_003219228.1 4035824..4036342(-) (ssbA) [Bacillus subtilis strain SRCM103773]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063XE16

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

100

100

1

  ssb Latilactobacillus sakei subsp. sakei 23K

58.192

100

0.599

  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

61.628

0.395

  ssb Glaesserella parasuis strain SC1401

35.519

100

0.378


Multiple sequence alignment