Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ETA10_RS12480 Genome accession   NZ_CP035397
Coordinates   2325052..2325426 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain SRCM103773     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2320052..2330426
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA10_RS12440 (ETA10_12440) yqhG 2320383..2321177 (+) 795 WP_014480249.1 YqhG family protein -
  ETA10_RS12445 (ETA10_12445) sinI 2321360..2321533 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETA10_RS12450 (ETA10_12450) sinR 2321567..2321902 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETA10_RS12455 (ETA10_12455) tasA 2321995..2322780 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ETA10_RS12460 (ETA10_12460) sipW 2322844..2323416 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ETA10_RS12465 (ETA10_12465) tapA 2323400..2324161 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ETA10_RS12470 (ETA10_12470) yqzG 2324433..2324759 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ETA10_RS12475 (ETA10_12475) spoIITA 2324801..2324980 (-) 180 WP_029726723.1 YqzE family protein -
  ETA10_RS12480 (ETA10_12480) comGG 2325052..2325426 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ETA10_RS12485 (ETA10_12485) comGF 2325427..2325810 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  ETA10_RS12490 (ETA10_12490) comGE 2325836..2326183 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene
  ETA10_RS12495 (ETA10_12495) comGD 2326167..2326598 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  ETA10_RS12500 (ETA10_12500) comGC 2326588..2326884 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ETA10_RS12505 (ETA10_12505) comGB 2326898..2327935 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  ETA10_RS12510 (ETA10_12510) comGA 2327922..2328992 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ETA10_RS12515 (ETA10_12515) - 2329204..2329401 (-) 198 WP_046160584.1 CBS domain-containing protein -
  ETA10_RS12520 (ETA10_12520) corA 2329403..2330356 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=339943 ETA10_RS12480 WP_014480253.1 2325052..2325426(-) (comGG) [Bacillus subtilis strain SRCM103773]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=339943 ETA10_RS12480 WP_014480253.1 2325052..2325426(-) (comGG) [Bacillus subtilis strain SRCM103773]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment