Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ETA10_RS12445 Genome accession   NZ_CP035397
Coordinates   2321360..2321533 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM103773     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2316360..2326533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA10_RS12430 (ETA10_12430) gcvT 2317159..2318247 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  ETA10_RS12435 (ETA10_12435) hepAA 2318689..2320362 (+) 1674 WP_038829735.1 SNF2-related protein -
  ETA10_RS12440 (ETA10_12440) yqhG 2320383..2321177 (+) 795 WP_014480249.1 YqhG family protein -
  ETA10_RS12445 (ETA10_12445) sinI 2321360..2321533 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETA10_RS12450 (ETA10_12450) sinR 2321567..2321902 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETA10_RS12455 (ETA10_12455) tasA 2321995..2322780 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ETA10_RS12460 (ETA10_12460) sipW 2322844..2323416 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ETA10_RS12465 (ETA10_12465) tapA 2323400..2324161 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ETA10_RS12470 (ETA10_12470) yqzG 2324433..2324759 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ETA10_RS12475 (ETA10_12475) spoIITA 2324801..2324980 (-) 180 WP_029726723.1 YqzE family protein -
  ETA10_RS12480 (ETA10_12480) comGG 2325052..2325426 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ETA10_RS12485 (ETA10_12485) comGF 2325427..2325810 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  ETA10_RS12490 (ETA10_12490) comGE 2325836..2326183 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=339941 ETA10_RS12445 WP_003230187.1 2321360..2321533(+) (sinI) [Bacillus subtilis strain SRCM103773]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=339941 ETA10_RS12445 WP_003230187.1 2321360..2321533(+) (sinI) [Bacillus subtilis strain SRCM103773]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment