Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ES966_RS12570 Genome accession   NZ_CP035393
Coordinates   2549579..2549956 (-) Length   125 a.a.
NCBI ID   WP_025649851.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM103691     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2544579..2554956
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES966_RS12530 (ES966_12530) - 2545076..2545870 (+) 795 WP_014305407.1 YqhG family protein -
  ES966_RS12535 (ES966_12535) sinI 2546047..2546220 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  ES966_RS12540 (ES966_12540) sinR 2546254..2546589 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ES966_RS12545 (ES966_12545) - 2546637..2547422 (-) 786 WP_017418136.1 TasA family protein -
  ES966_RS12550 (ES966_12550) - 2547487..2548071 (-) 585 WP_012117977.1 signal peptidase I -
  ES966_RS12555 (ES966_12555) tapA 2548043..2548714 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  ES966_RS12560 (ES966_12560) - 2548973..2549302 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ES966_RS12565 (ES966_12565) - 2549343..2549522 (-) 180 WP_003153093.1 YqzE family protein -
  ES966_RS12570 (ES966_12570) comGG 2549579..2549956 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  ES966_RS12575 (ES966_12575) comGF 2549957..2550352 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  ES966_RS12580 (ES966_12580) comGE 2550366..2550680 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ES966_RS12585 (ES966_12585) comGD 2550664..2551101 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ES966_RS12590 (ES966_12590) comGC 2551091..2551399 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ES966_RS12595 (ES966_12595) comGB 2551404..2552441 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  ES966_RS12600 (ES966_12600) comGA 2552428..2553498 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  ES966_RS12605 (ES966_12605) - 2553654..2554642 (-) 989 Protein_2430 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14151.04 Da        Isoelectric Point: 9.6404

>NTDB_id=339704 ES966_RS12570 WP_025649851.1 2549579..2549956(-) (comGG) [Bacillus velezensis strain SRCM103691]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FYITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=339704 ES966_RS12570 WP_025649851.1 2549579..2549956(-) (comGG) [Bacillus velezensis strain SRCM103691]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTTACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

52.419

99.2

0.52


Multiple sequence alignment