Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ES966_RS12535 | Genome accession | NZ_CP035393 |
| Coordinates | 2546047..2546220 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain SRCM103691 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2541047..2551220
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ES966_RS12520 (ES966_12520) | gcvT | 2541860..2542960 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ES966_RS12525 (ES966_12525) | - | 2543384..2545054 (+) | 1671 | WP_017418135.1 | SNF2-related protein | - |
| ES966_RS12530 (ES966_12530) | - | 2545076..2545870 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| ES966_RS12535 (ES966_12535) | sinI | 2546047..2546220 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| ES966_RS12540 (ES966_12540) | sinR | 2546254..2546589 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ES966_RS12545 (ES966_12545) | - | 2546637..2547422 (-) | 786 | WP_017418136.1 | TasA family protein | - |
| ES966_RS12550 (ES966_12550) | - | 2547487..2548071 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| ES966_RS12555 (ES966_12555) | tapA | 2548043..2548714 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ES966_RS12560 (ES966_12560) | - | 2548973..2549302 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ES966_RS12565 (ES966_12565) | - | 2549343..2549522 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ES966_RS12570 (ES966_12570) | comGG | 2549579..2549956 (-) | 378 | WP_025649851.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ES966_RS12575 (ES966_12575) | comGF | 2549957..2550352 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| ES966_RS12580 (ES966_12580) | comGE | 2550366..2550680 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ES966_RS12585 (ES966_12585) | comGD | 2550664..2551101 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=339702 ES966_RS12535 WP_014418369.1 2546047..2546220(+) (sinI) [Bacillus velezensis strain SRCM103691]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=339702 ES966_RS12535 WP_014418369.1 2546047..2546220(+) (sinI) [Bacillus velezensis strain SRCM103691]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |