Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   ES965_RS16400 Genome accession   NZ_CP035391
Coordinates   3125260..3125427 (-) Length   55 a.a.
NCBI ID   WP_100505762.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103689     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3120260..3130427
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES965_RS16370 (ES965_16370) mrpE 3120655..3121131 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  ES965_RS16375 (ES965_16375) mrpF 3121131..3121415 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  ES965_RS16380 (ES965_16380) mnhG 3121399..3121773 (+) 375 WP_015714623.1 monovalent cation/H(+) antiporter subunit G -
  ES965_RS16385 (ES965_16385) yuxO 3121812..3122192 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  ES965_RS16390 (ES965_16390) comA 3122211..3122855 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ES965_RS16395 (ES965_16395) comP 3122936..3125245 (-) 2310 WP_129092677.1 two-component system sensor histidine kinase ComP Regulator
  ES965_RS16400 (ES965_16400) comX 3125260..3125427 (-) 168 WP_100505762.1 competence pheromone ComX Regulator
  ES965_RS16405 (ES965_16405) comQ 3125411..3126313 (-) 903 WP_129092678.1 polyprenyl synthetase family protein Regulator
  ES965_RS16410 (ES965_16410) degQ 3126498..3126638 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ES965_RS21865 - 3126860..3126922 (+) 63 Protein_3156 hypothetical protein -
  ES965_RS16415 (ES965_16415) - 3127100..3127468 (+) 369 WP_129092679.1 hypothetical protein -
  ES965_RS16420 (ES965_16420) pdeH 3127444..3128673 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  ES965_RS16425 (ES965_16425) pncB 3128810..3130282 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6505.42 Da        Isoelectric Point: 4.3494

>NTDB_id=339646 ES965_RS16400 WP_100505762.1 3125260..3125427(-) (comX) [Bacillus subtilis strain SRCM103689]
MQDLINYFLNYPEVLKKLKNKEACLIGFDVQETETIIKAYNDYYLSGPITREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=339646 ES965_RS16400 WP_100505762.1 3125260..3125427(-) (comX) [Bacillus subtilis strain SRCM103689]
ATGCAAGACCTAATTAACTATTTTTTAAATTATCCTGAGGTTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACAGAAACAATAATTAAAGCTTATAATGATTATTATTTGTCTGGCCCAATAACTCGTGAATGGG
ATGGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

92.453

96.364

0.891

Multiple sequence alignment