Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   EM806_RS00720 Genome accession   NZ_CP035106
Coordinates   151761..151886 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpbs3     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 146761..156886
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EM806_RS00695 - 146821..149043 (+) 2223 WP_128479295.1 ATP-dependent Clp protease ATP-binding subunit -
  EM806_RS00700 panD 149033..149383 (+) 351 WP_128479297.1 aspartate 1-decarboxylase -
  EM806_RS00705 - 149394..149687 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  EM806_RS00710 - 149687..150682 (+) 996 WP_128480354.1 PDZ domain-containing protein -
  EM806_RS00715 comB6 150690..151745 (+) 1056 WP_120930618.1 P-type conjugative transfer protein TrbL Machinery gene
  EM806_RS00720 comB7 151761..151886 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  EM806_RS00725 comB8 151883..152626 (+) 744 WP_128018270.1 virB8 family protein Machinery gene
  EM806_RS00730 comB9 152626..153591 (+) 966 WP_128479298.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EM806_RS00735 comB10 153584..154720 (+) 1137 WP_128479300.1 DNA type IV secretion system protein ComB10 Machinery gene
  EM806_RS00740 - 154786..156198 (+) 1413 WP_128479301.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=334493 EM806_RS00720 WP_001217874.1 151761..151886(+) (comB7) [Helicobacter pylori strain Hpbs3]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=334493 EM806_RS00720 WP_001217874.1 151761..151886(+) (comB7) [Helicobacter pylori strain Hpbs3]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAATAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878

Multiple sequence alignment