Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   EM803_RS00755 Genome accession   NZ_CP035105
Coordinates   152000..152125 (+) Length   41 a.a.
NCBI ID   WP_075668089.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpbs2     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 147000..157125
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EM803_RS00730 - 147060..149282 (+) 2223 WP_128480956.1 ATP-dependent Clp protease ATP-binding subunit -
  EM803_RS00735 panD 149272..149622 (+) 351 WP_000142212.1 aspartate 1-decarboxylase -
  EM803_RS00740 - 149633..149926 (+) 294 WP_128480957.1 YbaB/EbfC family nucleoid-associated protein -
  EM803_RS00745 - 149926..150921 (+) 996 WP_128481772.1 PDZ domain-containing protein -
  EM803_RS00750 comB6 150929..151984 (+) 1056 WP_128481771.1 P-type conjugative transfer protein TrbL Machinery gene
  EM803_RS00755 comB7 152000..152125 (+) 126 WP_075668089.1 comB7 lipoprotein Machinery gene
  EM803_RS00760 comB8 152122..152865 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  EM803_RS00765 comB9 152865..153836 (+) 972 WP_128480958.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EM803_RS00770 comB10 153829..154965 (+) 1137 WP_128480959.1 DNA type IV secretion system protein ComB10 Machinery gene
  EM803_RS00775 - 155035..156447 (+) 1413 WP_128480960.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4738.72 Da        Isoelectric Point: 9.3278

>NTDB_id=334472 EM803_RS00755 WP_075668089.1 152000..152125(+) (comB7) [Helicobacter pylori strain Hpbs2]
MRIFSVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=334472 EM803_RS00755 WP_075668089.1 152000..152125(+) (comB7) [Helicobacter pylori strain Hpbs2]
ATGAGAATTTTTTCTGTCATTATGGGACTAGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment