Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | SP70585_RS00150 | Genome accession | NC_012468 |
| Coordinates | 22901..23137 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939546.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae 70585 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12370..75671 | 22901..23137 | within | 0 |
| IS/Tn | 22378..22584 | 22901..23137 | flank | 317 |
Gene organization within MGE regions
Location: 12370..75671
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP70585_RS00095 (SP70585_0013) | ftsH | 12370..14328 (+) | 1959 | WP_000744551.1 | ATP-dependent zinc metalloprotease FtsH | - |
| SP70585_RS00100 (SP70585_0014) | - | 14392..15648 (-) | 1257 | WP_000436399.1 | ISL3 family transposase | - |
| SP70585_RS00105 (SP70585_0015) | comX/comX2 | 15872..16351 (+) | 480 | WP_000588873.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| SP70585_RS11880 (SP70585_0023) | - | 21901..22110 (+) | 210 | Protein_15 | transposase | - |
| SP70585_RS11885 | - | 22119..22635 (-) | 517 | Protein_16 | ISL3 family transposase | - |
| SP70585_RS00150 (SP70585_0026) | comW | 22901..23137 (+) | 237 | WP_000939546.1 | sigma(X)-activator ComW | Regulator |
| SP70585_RS00155 (SP70585_0027) | - | 23368..24654 (+) | 1287 | WP_041170973.1 | adenylosuccinate synthase | - |
| SP70585_RS00160 (SP70585_0028) | - | 24896..26044 (-) | 1149 | WP_000876735.1 | site-specific integrase | - |
| SP70585_RS00165 (SP70585_0029) | - | 26216..27130 (-) | 915 | WP_000690123.1 | HIRAN domain-containing protein | - |
| SP70585_RS00170 (SP70585_0030) | - | 27142..27525 (-) | 384 | WP_000136460.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SP70585_RS00175 (SP70585_0031) | - | 27538..27903 (-) | 366 | WP_000484469.1 | helix-turn-helix domain-containing protein | - |
| SP70585_RS13460 (SP70585_0032) | - | 28189..28335 (+) | 147 | WP_001001334.1 | hypothetical protein | - |
| SP70585_RS00180 (SP70585_0033) | - | 28328..28531 (+) | 204 | WP_000032095.1 | helix-turn-helix transcriptional regulator | - |
| SP70585_RS00185 (SP70585_0035) | - | 28674..29387 (+) | 714 | WP_001002347.1 | ORF6C domain-containing protein | - |
| SP70585_RS00190 (SP70585_0036) | - | 29399..29656 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| SP70585_RS00195 (SP70585_0037) | - | 29742..30062 (+) | 321 | WP_000462826.1 | hypothetical protein | - |
| SP70585_RS00200 (SP70585_0038) | - | 30078..30377 (+) | 300 | WP_000391810.1 | hypothetical protein | - |
| SP70585_RS00205 (SP70585_0039) | - | 30368..31156 (+) | 789 | WP_001185499.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SP70585_RS13465 (SP70585_0040) | - | 31144..31302 (+) | 159 | WP_000511766.1 | hypothetical protein | - |
| SP70585_RS00210 (SP70585_0041) | - | 31296..32066 (+) | 771 | WP_000228202.1 | ATP-binding protein | - |
| SP70585_RS00215 (SP70585_0042) | - | 32081..32275 (+) | 195 | WP_000470343.1 | hypothetical protein | - |
| SP70585_RS00220 (SP70585_0043) | - | 32275..32502 (+) | 228 | WP_000891972.1 | hypothetical protein | - |
| SP70585_RS11890 (SP70585_0044) | - | 32629..32793 (+) | 165 | WP_000233201.1 | hypothetical protein | - |
| SP70585_RS00225 | - | 32783..32992 (+) | 210 | WP_001105098.1 | hypothetical protein | - |
| SP70585_RS00230 (SP70585_0045) | - | 32964..33281 (+) | 318 | WP_000969662.1 | hypothetical protein | - |
| SP70585_RS00235 (SP70585_0046) | - | 33283..33792 (+) | 510 | WP_001041149.1 | DUF1642 domain-containing protein | - |
| SP70585_RS00240 (SP70585_0047) | - | 33785..34375 (+) | 591 | WP_001030727.1 | DUF1642 domain-containing protein | - |
| SP70585_RS14090 (SP70585_0048) | - | 34414..34536 (+) | 123 | WP_001842508.1 | hypothetical protein | - |
| SP70585_RS14095 (SP70585_0049) | - | 34533..34667 (+) | 135 | WP_000819326.1 | hypothetical protein | - |
| SP70585_RS00245 (SP70585_0050) | - | 34680..35069 (+) | 390 | WP_000612394.1 | YopX family protein | - |
| SP70585_RS00250 (SP70585_0051) | - | 35069..35305 (+) | 237 | WP_001067623.1 | DUF3310 domain-containing protein | - |
| SP70585_RS13470 | - | 35298..35474 (+) | 177 | WP_000005959.1 | hypothetical protein | - |
| SP70585_RS00255 (SP70585_0052) | - | 35467..35697 (+) | 231 | WP_000998323.1 | helix-turn-helix domain-containing protein | - |
| SP70585_RS00260 (SP70585_0053) | - | 35770..36198 (+) | 429 | WP_001165369.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SP70585_RS00265 (SP70585_0054) | - | 36488..37054 (+) | 567 | WP_000754954.1 | site-specific integrase | - |
| SP70585_RS00270 (SP70585_0056) | - | 37288..37632 (+) | 345 | WP_001095653.1 | HNH endonuclease | - |
| SP70585_RS00280 (SP70585_0057) | - | 37771..39075 (+) | 1305 | WP_000172769.1 | hypothetical protein | - |
| SP70585_RS00285 (SP70585_0058) | - | 39029..40420 (+) | 1392 | WP_000228948.1 | hypothetical protein | - |
| SP70585_RS00290 (SP70585_0059) | - | 40410..40649 (+) | 240 | WP_000834150.1 | hypothetical protein | - |
| SP70585_RS00295 (SP70585_0060) | - | 40702..40932 (+) | 231 | WP_000528517.1 | hypothetical protein | - |
| SP70585_RS00300 (SP70585_0061) | - | 40983..42395 (+) | 1413 | WP_000101486.1 | DEAD/DEAH box helicase family protein | - |
| SP70585_RS00305 (SP70585_0062) | - | 42477..42941 (+) | 465 | WP_001288684.1 | DUF4355 domain-containing protein | - |
| SP70585_RS00310 (SP70585_0063) | - | 42947..43846 (+) | 900 | WP_000774646.1 | phage major capsid protein | - |
| SP70585_RS00315 (SP70585_0064) | - | 43852..44064 (+) | 213 | WP_001240369.1 | HeH/LEM domain-containing protein | - |
| SP70585_RS00320 (SP70585_0065) | - | 44068..44508 (+) | 441 | WP_000526245.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SP70585_RS00325 (SP70585_0066) | - | 44453..44791 (+) | 339 | WP_000221695.1 | hypothetical protein | - |
| SP70585_RS00330 (SP70585_0067) | - | 44784..45020 (+) | 237 | WP_000069060.1 | hypothetical protein | - |
| SP70585_RS00335 (SP70585_0068) | - | 45017..45352 (+) | 336 | WP_000571659.1 | hypothetical protein | - |
| SP70585_RS00340 (SP70585_0069) | - | 45368..45976 (+) | 609 | WP_000205998.1 | hypothetical protein | - |
| SP70585_RS00345 (SP70585_0070) | - | 45982..46257 (+) | 276 | WP_000387407.1 | hypothetical protein | - |
| SP70585_RS00350 (SP70585_0071) | - | 46269..46655 (+) | 387 | WP_000560881.1 | DUF5361 domain-containing protein | - |
| SP70585_RS00355 (SP70585_0072) | - | 46655..49120 (+) | 2466 | WP_000179967.1 | hypothetical protein | - |
| SP70585_RS00360 (SP70585_0073) | - | 49120..49818 (+) | 699 | WP_000499607.1 | adenylosuccinate synthetase | - |
| SP70585_RS00365 (SP70585_0074) | - | 49815..58727 (+) | 8913 | WP_000639852.1 | phage tail spike protein | - |
| SP70585_RS14210 | - | 58724..58841 (+) | 118 | Protein_66 | dihydrodipicolinate reductase | - |
| SP70585_RS00370 (SP70585_0075) | - | 58822..59025 (+) | 204 | WP_001091112.1 | hypothetical protein | - |
| SP70585_RS00375 (SP70585_0076) | - | 59028..59378 (+) | 351 | WP_000852245.1 | hypothetical protein | - |
| SP70585_RS00380 (SP70585_0077) | - | 59387..59803 (+) | 417 | WP_001165339.1 | phage holin family protein | - |
| SP70585_RS00385 (SP70585_0078) | - | 59807..60142 (+) | 336 | WP_001186204.1 | phage holin | - |
| SP70585_RS00390 (SP70585_0079) | - | 60142..61098 (+) | 957 | WP_000350532.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| SP70585_RS00395 (SP70585_0080) | - | 61236..61415 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| SP70585_RS13475 | - | 61557..61706 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| SP70585_RS00400 (SP70585_0081) | tadA | 61967..62434 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| SP70585_RS00405 (SP70585_0082) | - | 62620..63063 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| SP70585_RS00410 (SP70585_0083) | - | 63065..63580 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| SP70585_RS00415 (SP70585_0084) | radA | 63594..64955 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| SP70585_RS00420 (SP70585_0085) | - | 65028..65525 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| SP70585_RS00425 (SP70585_0086) | - | 65550..66365 (+) | 816 | WP_000749768.1 | PrsW family intramembrane metalloprotease | - |
| SP70585_RS00430 (SP70585_0087) | - | 66510..67478 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| SP70585_RS11900 (SP70585_0088) | - | 67612..67893 (-) | 282 | Protein_81 | ISL3 family transposase | - |
| SP70585_RS13720 | - | 68020..68927 (-) | 908 | Protein_82 | Rpn family recombination-promoting nuclease/putative transposase | - |
| SP70585_RS00450 (SP70585_0092) | polA | 69183..71816 (+) | 2634 | WP_012677111.1 | DNA polymerase I | - |
| SP70585_RS00455 (SP70585_0093) | - | 71901..72338 (+) | 438 | WP_000076483.1 | CoA-binding protein | - |
| SP70585_RS00460 (SP70585_0094) | - | 72576..73586 (-) | 1011 | WP_000009183.1 | YeiH family protein | - |
| SP70585_RS00465 (SP70585_0095) | - | 73735..74904 (+) | 1170 | WP_000366342.1 | pyridoxal phosphate-dependent aminotransferase | - |
| SP70585_RS00470 (SP70585_0096) | recO | 74901..75671 (+) | 771 | WP_000616164.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9686.14 Da Isoelectric Point: 6.7051
>NTDB_id=33283 SP70585_RS00150 WP_000939546.1 22901..23137(+) (comW) [Streptococcus pneumoniae 70585]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=33283 SP70585_RS00150 WP_000939546.1 22901..23137(+) (comW) [Streptococcus pneumoniae 70585]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGGTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGGTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae D39 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae R6 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae TIGR4 |
98.718 |
100 |
0.987 |
| comW | Streptococcus mitis SK321 |
76.923 |
100 |
0.769 |
| comW | Streptococcus mitis NCTC 12261 |
76.623 |
98.718 |
0.756 |