Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   EI562_RS11290 Genome accession   NZ_CP034336
Coordinates   2236310..2236846 (-) Length   178 a.a.
NCBI ID   WP_006785953.1    Uniprot ID   -
Organism   Enterobacter asburiae strain CAV1043     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2169920..2248663 2236310..2236846 within 0


Gene organization within MGE regions


Location: 2169920..2248663
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EI562_RS10940 (EI562_10940) - 2170150..2171151 (-) 1002 WP_006781417.1 site-specific integrase -
  EI562_RS10945 (EI562_10945) - 2171209..2172852 (-) 1644 WP_006781415.1 conjugal transfer nickase/helicase domain-containing protein -
  EI562_RS10950 (EI562_10950) - 2172919..2174427 (-) 1509 WP_006781413.1 UvrD-helicase domain-containing protein -
  EI562_RS10955 (EI562_10955) - 2174556..2175239 (-) 684 WP_006781411.1 N-6 DNA methylase -
  EI562_RS10960 (EI562_10960) - 2175348..2176280 (-) 933 WP_006781409.1 DUF1281 domain-containing protein -
  EI562_RS10965 (EI562_10965) - 2176386..2177372 (-) 987 WP_006781408.1 ArdC family protein -
  EI562_RS10970 (EI562_10970) - 2177454..2177801 (-) 348 WP_006781405.1 hypothetical protein -
  EI562_RS10975 (EI562_10975) - 2177869..2178471 (-) 603 WP_006781404.1 DUF3085 domain-containing protein -
  EI562_RS10980 (EI562_10980) - 2178547..2179194 (-) 648 WP_006781402.1 hypothetical protein -
  EI562_RS10985 (EI562_10985) - 2179279..2179644 (-) 366 WP_006781400.1 hypothetical protein -
  EI562_RS25090 - 2180107..2180475 (-) 369 WP_154283625.1 hypothetical protein -
  EI562_RS11010 (EI562_11010) pcoE 2182971..2183405 (-) 435 WP_004388336.1 copper resistance system metallochaperone PcoE -
  EI562_RS11015 (EI562_11015) pcoS 2183621..2185021 (-) 1401 WP_006785898.1 copper resistance membrane spanning protein PcoS -
  EI562_RS11020 (EI562_11020) pcoR 2185018..2185698 (-) 681 WP_001188930.1 copper response regulator transcription factor PcoR -
  EI562_RS11025 (EI562_11025) pcoD 2185753..2186631 (-) 879 WP_229692861.1 copper resistance inner membrane protein PcoD -
  EI562_RS11030 (EI562_11030) pcoC 2186687..2187067 (-) 381 WP_000025662.1 copper resistance system metallochaperone PcoC -
  EI562_RS11035 (EI562_11035) pcoB 2187107..2187997 (-) 891 WP_006785895.1 copper resistance outer membrane transporter PcoB -
  EI562_RS11040 (EI562_11040) pcoA 2188003..2189820 (-) 1818 WP_000925242.1 multicopper oxidase PcoA -
  EI562_RS11045 (EI562_11045) - 2190054..2190503 (+) 450 WP_001023257.1 copper resistance protein -
  EI562_RS11050 (EI562_11050) - 2190792..2191529 (+) 738 WP_004118669.1 peptidoglycan DD-metalloendopeptidase family protein -
  EI562_RS11055 (EI562_11055) - 2191563..2191760 (-) 198 WP_000843497.1 DUF2933 domain-containing protein -
  EI562_RS11060 (EI562_11060) silP 2191801..2194272 (-) 2472 WP_129244003.1 Ag(+)-translocating P-type ATPase SilP -
  EI562_RS11065 (EI562_11065) - 2194370..2194810 (-) 441 WP_002436620.1 DUF411 domain-containing protein -
  EI562_RS11070 (EI562_11070) silA 2194897..2198043 (-) 3147 WP_000574021.1 Cu(+)/Ag(+) efflux RND transporter permease subunit SilA -
  EI562_RS11075 (EI562_11075) silB 2198054..2199346 (-) 1293 WP_001485328.1 Cu(+)/Ag(+) efflux RND transporter periplasmic adaptor subunit SilB -
  EI562_RS11080 (EI562_11080) cusF 2199460..2199813 (-) 354 WP_001246153.1 cation efflux system protein CusF -
  EI562_RS11085 (EI562_11085) silC 2199842..2201227 (-) 1386 WP_000475503.1 Cu(+)/Ag(+) efflux RND transporter outer membrane channel SilC -
  EI562_RS11090 (EI562_11090) silR 2201417..2202097 (+) 681 WP_000697968.1 copper/silver response regulator transcription factor SilR -
  EI562_RS11095 (EI562_11095) silS 2202090..2203565 (+) 1476 WP_000555738.1 copper/silver sensor histidine kinase SilS -
  EI562_RS11100 (EI562_11100) silE 2203815..2204246 (+) 432 WP_006785880.1 silver-binding protein SilE -
  EI562_RS11105 (EI562_11105) - 2204395..2204745 (+) 351 WP_006785879.1 DUF305 domain-containing protein -
  EI562_RS11110 (EI562_11110) - 2204912..2205595 (-) 684 Protein_2157 TOPRIM nucleotidyl transferase/hydrolase domain-containing protein -
  EI562_RS11120 (EI562_11120) - 2207160..2207777 (+) 618 WP_020899211.1 recombinase family protein -
  EI562_RS11125 (EI562_11125) - 2207846..2208745 (-) 900 WP_006786007.1 integrase domain-containing protein -
  EI562_RS11130 (EI562_11130) - 2209677..2210375 (-) 699 WP_020899212.1 hypothetical protein -
  EI562_RS25330 - 2210436..2210627 (-) 192 WP_202816119.1 hypothetical protein -
  EI562_RS11140 (EI562_11140) umuC 2211133..2212404 (-) 1272 WP_023310105.1 translesion error-prone DNA polymerase V subunit UmuC -
  EI562_RS11145 (EI562_11145) umuD 2212407..2212844 (-) 438 WP_029376740.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  EI562_RS11150 (EI562_11150) - 2213531..2215051 (-) 1521 WP_006785984.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  EI562_RS11155 (EI562_11155) - 2215054..2215392 (-) 339 WP_020899218.1 hypothetical protein -
  EI562_RS11160 (EI562_11160) - 2215403..2216878 (-) 1476 WP_020899219.1 integrating conjugative element protein -
  EI562_RS11165 (EI562_11165) - 2216878..2217870 (-) 993 WP_020899220.1 TIGR03756 family integrating conjugative element protein -
  EI562_RS11170 (EI562_11170) - 2217867..2218265 (-) 399 WP_006785980.1 TIGR03757 family integrating conjugative element protein -
  EI562_RS11175 (EI562_11175) - 2218602..2219147 (+) 546 WP_223151192.1 hypothetical protein -
  EI562_RS11180 (EI562_11180) - 2219260..2219637 (-) 378 WP_004115528.1 hypothetical protein -
  EI562_RS11185 (EI562_11185) - 2219634..2222492 (-) 2859 WP_023202704.1 conjugative transfer ATPase -
  EI562_RS11190 (EI562_11190) - 2222492..2222902 (-) 411 WP_006785978.1 TIGR03751 family conjugal transfer lipoprotein -
  EI562_RS11195 (EI562_11195) - 2222902..2223297 (-) 396 WP_020899223.1 hypothetical protein -
  EI562_RS11200 (EI562_11200) - 2223281..2224780 (-) 1500 WP_006785974.1 TIGR03752 family integrating conjugative element protein -
  EI562_RS11205 (EI562_11205) - 2224770..2225720 (-) 951 WP_006785972.1 TIGR03749 family integrating conjugative element protein -
  EI562_RS11210 (EI562_11210) - 2225720..2226379 (-) 660 WP_004115533.1 PFL_4703 family integrating conjugative element protein -
  EI562_RS11215 (EI562_11215) - 2226376..2226732 (-) 357 WP_004115534.1 TIGR03750 family conjugal transfer protein -
  EI562_RS11220 (EI562_11220) - 2226745..2227131 (-) 387 WP_006785968.1 TIGR03745 family integrating conjugative element membrane protein -
  EI562_RS11225 (EI562_11225) - 2227167..2227409 (-) 243 WP_003029734.1 TIGR03758 family integrating conjugative element protein -
  EI562_RS11230 (EI562_11230) - 2227409..2227756 (-) 348 WP_006785967.1 RAQPRD family integrative conjugative element protein -
  EI562_RS11235 (EI562_11235) - 2227941..2228288 (+) 348 WP_016808262.1 FxLYD domain-containing protein -
  EI562_RS11240 (EI562_11240) - 2228379..2229137 (-) 759 WP_006785966.1 TIGR03747 family integrating conjugative element membrane protein -
  EI562_RS11245 (EI562_11245) traD 2229130..2231229 (-) 2100 WP_006785965.1 type IV conjugative transfer system coupling protein TraD -
  EI562_RS11250 (EI562_11250) - 2231222..2231710 (-) 489 WP_006785964.1 hypothetical protein -
  EI562_RS11255 (EI562_11255) - 2231721..2232293 (-) 573 WP_006785963.1 restriction endonuclease -
  EI562_RS11260 (EI562_11260) - 2232293..2232826 (-) 534 WP_006785962.1 integrating conjugative element protein -
  EI562_RS11265 (EI562_11265) - 2232832..2233467 (-) 636 WP_006785961.1 transglycosylase SLT domain-containing protein -
  EI562_RS11270 (EI562_11270) - 2233446..2234168 (-) 723 WP_006785960.1 TIGR03759 family integrating conjugative element protein -
  EI562_RS11275 (EI562_11275) - 2234180..2234938 (-) 759 WP_020899224.1 hypothetical protein -
  EI562_RS11280 (EI562_11280) - 2234935..2235600 (-) 666 WP_006785957.1 PilL N-terminal domain-containing protein -
  EI562_RS11285 (EI562_11285) - 2235739..2236176 (-) 438 WP_023310103.1 DUF29 domain-containing protein -
  EI562_RS11290 (EI562_11290) ssb 2236310..2236846 (-) 537 WP_006785953.1 single-stranded DNA-binding protein Machinery gene
  EI562_RS11295 (EI562_11295) - 2236907..2237377 (-) 471 WP_006785950.1 STY4534 family ICE replication protein -
  EI562_RS11300 (EI562_11300) - 2238015..2240036 (-) 2022 WP_006777725.1 DNA topoisomerase III -
  EI562_RS11305 (EI562_11305) - 2240052..2240606 (-) 555 WP_006777724.1 hypothetical protein -
  EI562_RS11310 (EI562_11310) - 2240608..2241321 (-) 714 WP_010615557.1 PFL_4669 family integrating conjugative element protein -
  EI562_RS11315 (EI562_11315) - 2241738..2242976 (-) 1239 WP_006777723.1 STY4528 family pathogenicity island replication protein -
  EI562_RS11320 (EI562_11320) - 2243076..2243324 (-) 249 WP_004115572.1 hypothetical protein -
  EI562_RS11325 (EI562_11325) - 2243321..2243911 (-) 591 WP_006777722.1 DUF2857 domain-containing protein -
  EI562_RS11330 (EI562_11330) - 2243918..2244628 (-) 711 WP_006777721.1 DUF2786 domain-containing protein -
  EI562_RS11335 (EI562_11335) - 2244621..2246315 (-) 1695 WP_006777719.1 ParB family protein -
  EI562_RS11340 (EI562_11340) dnaB-PI 2246312..2247682 (-) 1371 WP_006777718.1 SPI-7-type island replicative DNA helicase -
  EI562_RS11345 (EI562_11345) - 2247675..2248550 (-) 876 WP_006777717.1 ParA family protein -

Sequence


Protein


Download         Length: 178 a.a.        Molecular weight: 19246.33 Da        Isoelectric Point: 6.2363

>NTDB_id=330738 EI562_RS11290 WP_006785953.1 2236310..2236846(-) (ssb) [Enterobacter asburiae strain CAV1043]
MSSRGVNKVILVGNLGQDPEVRYIPNGSAVATLSLATSESWRDKQSGEQKEVTEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLRTRKWTDQAGQEKYTTEVVVNIGGTMQMLGGRQSGSGQNTSSRNDWGQPQQPSGPTHSGQASGSSAGAPPMDFDDD
IPFIGFGYDCSRVAIHAL

Nucleotide


Download         Length: 537 bp        

>NTDB_id=330738 EI562_RS11290 WP_006785953.1 2236310..2236846(-) (ssb) [Enterobacter asburiae strain CAV1043]
ATGTCCTCACGCGGCGTTAACAAGGTTATCCTTGTCGGAAACCTCGGCCAGGATCCTGAAGTTCGTTATATTCCCAACGG
CAGTGCAGTTGCCACCCTTTCTCTGGCCACGTCTGAGAGCTGGCGCGATAAGCAGTCCGGCGAACAGAAAGAAGTGACCG
AATGGCACAGGGTGGTTATTTTCGGCAAGCTGGCAGAAATTGCGGGTGAATATCTGCGCAAAGGCTCCCAGGTTTACATC
GAGGGTCAGCTGCGCACACGCAAATGGACCGATCAGGCCGGCCAGGAGAAATACACCACAGAGGTGGTGGTCAATATTGG
TGGCACCATGCAGATGCTTGGCGGCCGCCAGTCCGGCAGCGGACAGAATACGTCTTCCCGGAATGACTGGGGGCAGCCTC
AGCAACCTTCAGGACCGACTCACAGTGGCCAGGCCTCCGGCAGCAGTGCCGGTGCGCCACCGATGGACTTCGATGACGAT
ATACCGTTCATTGGATTCGGGTATGACTGTTCCAGAGTGGCAATTCACGCCCTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

63.842

99.438

0.635

  ssb Glaesserella parasuis strain SC1401

49.724

100

0.506

  ssb Neisseria meningitidis MC58

44.633

99.438

0.444

  ssb Neisseria gonorrhoeae MS11

44.318

98.876

0.438


Multiple sequence alignment