Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   EAL91_RS01110 Genome accession   NZ_CP034147
Coordinates   223844..223957 (-) Length   37 a.a.
NCBI ID   WP_001217870.1    Uniprot ID   -
Organism   Helicobacter pylori strain HP14039     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 218844..228957
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EAL91_RS01090 - 219500..220912 (-) 1413 WP_121054119.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  EAL91_RS01095 comB10 220983..222119 (-) 1137 WP_121054120.1 DNA type IV secretion system protein ComB10 Machinery gene
  EAL91_RS01100 comB9 222112..223104 (-) 993 WP_121054121.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EAL91_RS01105 comB8 223104..223847 (-) 744 WP_121054122.1 virB8 family protein Machinery gene
  EAL91_RS01110 comB7 223844..223957 (-) 114 WP_001217870.1 hypothetical protein Machinery gene
  EAL91_RS01115 comB6 223973..225028 (-) 1056 WP_121054123.1 P-type conjugative transfer protein TrbL Machinery gene
  EAL91_RS01120 - 225036..226040 (-) 1005 WP_121054124.1 PDZ domain-containing protein -
  EAL91_RS01125 - 226040..226342 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  EAL91_RS01130 panD 226345..226698 (-) 354 WP_000142278.1 aspartate 1-decarboxylase -
  EAL91_RS01135 - 226688..228910 (-) 2223 WP_121054125.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=329344 EAL91_RS01110 WP_001217870.1 223844..223957(-) (comB7) [Helicobacter pylori strain HP14039]
MRIFFVIMGLLLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=329344 EAL91_RS01110 WP_001217870.1 223844..223957(-) (comB7) [Helicobacter pylori strain HP14039]
ATGAGAATTTTTTTTGTTATCATGGGACTTTTGTTATTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946

Multiple sequence alignment